Реферат : Клонирование и анализ генов легких цепей иммуноглобулинов стерляди 


Полнотекстовый поиск по базе:

Главная >> Реферат >> Медицина, здоровье


Клонирование и анализ генов легких цепей иммуноглобулинов стерляди




9

ÎÃËÀÂËÅÍÈÅ

ÑÏÈÑÎÊ ÑÎÊÐÀÙÅÍÈÉ..............................................................................................3

ÂÂÅÄÅÍÈÅ.............................................................................................................................4

ÎÁÇÎÐ ËÈÒÅÐÀÒÓÐÛ......................................................................................................5

ÑÒÐÎÅÍÈÅ ÈÌÌÓÍÎÃËÎÁÓËÈÍÎÂ...................................................................................5

ÃÅÍÎÌÍÀß ÎÐÃÀÍÈÇÀÖÈß È ÝÊÑÏÐÅÑÑÈß

ÃÅÍÎÂ L-ÖÅÏÅÉ ÈÃ Ó ÌËÅÊÎÏÈÒÀÞÙÈÕ....................................................................7

ÃÅÍÎÌÍÀß ÎÐÃÀÍÈÇÀÖÈß È ÝÊÑÏÐÅÑÑÈß

ÃÅÍΠL-ÖÅÏÅÉ ÈÃ Ó ÍÈÇØÈÕ ÏÎÇÂÎÍÎ×ÍÛÕ......................................................11

ÝÂÎËÞÖÈß ÃÅÍÎÂ L-ÖÅÏÅÉ ÈÃ.......................................................................................19

ÌÀÒÅÐÈÀËÛ È ÌÅÒÎÄÛ...........................................................................................24

ÝËÅÊÒÐÎÔÎÐÅÇ ÄÍÊ............................................................................................................24

ÂÛÄÅËÅÍÈÅ ÄÍÊ ÈÇ ÃÅËß.................................................................................................24

ÏÎËÓ×ÅÍÈÅ ÐÀÄÈÎÀÊÒÈÂÍÛÕ ÇÎÍÄÎÂ......................................................................25

ÂÛÄÅËÅÍÈÅ ÏËÀÇÌÈÄÍÎÉ ÄÍÊ......................................................................................26

Î×ÈÑÒÊÀ ÏËÀÇÌÈÄÍÎÉ ÄÍÊ ÌÅÒÎÄÎÌ ÐÀÂÍÎÂÅÑÍÎÃÎ

ÖÅÍÒÐÈÔÓÃÈÐÎÂÀÍÈß Â ÃÐÀÄÈÅÍÒÅ ÏËÎÒÍÎÑÒÈ CsCl........................................26

ÒÐÀÍÑÔÎÐÌÀÖÈß ÏÐÎÊÀÐÈÎÒÈ×ÅÑÊÈÕ ÊËÅÒÎÊ...................................................27

ÂÛÄÅËÅÍÈÅ ËÅÉÊÎÖÈÒÎÂ ÈÇ ÊÐÎÂÈ ÐÛÁ.................................................................28

ÂÛÄÅËÅÍÈÅ ÑÓÌÌÀÐÍÎÉ ÐÍÊ ÈÇ ËÅÉÊÎÖÈÒÎÂ.....................................................28

ÂÛÄÅËÅÍÈÅ ÂÛÑÎÊÎÌÎËÅÊÓËßÐÍÎÉ ÄÍÊ

ÈÇ ÝÓÊÀÐÈÎÒÈ×ÅÑÊÈÕ ÊËÅÒÎÊ.....................................................................................28

ÊÎÍÑÒÐÓÈÐÎÂÀÍÈÅ ÁÈÁËÈÎÒÅÊÈ êÄÍÊ......................................................................29

ÏÎËÈÌÅÐÀÇÍÀß ÖÅÏÍÀß ÐÅÀÊÖÈß...............................................................................33

ÑÓÁÊËÎÍÈÐÎÂÀÍÈÅ ÄÍÊ...................................................................................................34

ÑÊÐÈÍÈÍà ÁÈÁËÈÎÒÅÊÈ êÄÍÊ........................................................................................34

ÎÏÐÅÄÅËÅÍÈÅ ÍÓÊËÅÎÒÈÄÍÎÉ ÏÎÑËÅÄÎÂÀÒÅËÜÍÎÑÒÈ ÄÍÊ.............................35

ÑÀÓÇÅÐÍ ÁËÎÒ ÃÈÁÐÈÄÈÇÀÖÈß.....................................................................................36

ÐÅÇÓËÜÒÀÒÛ.....................................................................................................................38

ÊÎÍÑÒÐÓÈÐÎÂÀÍÈÅ ÁÈÁËÈÎÒÅÊÈ êÄÍÊ È ÅÅ ÑÊÐÈÍÈÍÃ.....................................38

ÎÏÐÅÄÅËÅÍÈÅ ÏÅÐÂÈ×ÍÎÉ ÑÒÐÓÊÒÓÐÛ......................................................................40

ÑÐÀÂÍÈÒÅËÜÍÛÉ ÀÍÀËÈÇ ÏÅÐÂÈ×ÍÎÉ ÑÒÐÓÊÒÓÐÛ..............................................40

ÀÍÀËÈÇ ÃÅÍÎÌÍÎÉ ÎÐÃÀÍÈÇÀÖÈÈ..............................................................................41

ÎÁÑÓÆÄÅÍÈÅ....................................................................................................................46

ÂÛÂÎÄÛ...............................................................................................................................48

ÑÏÈÑÎÊ ËÈÒÅÐÀÒÓÐÛ................................................................................................49

ÑÏÈÑÎÊ ÑÎÊÐÀÙÅÍÈÉ

ÈÃ èììóíîãëîáóëèíû

ïí ïàð íóêëåîòèäîâ

òïí òûñÿ÷ ïàð íóêëåîòèäîâ

å.à. åäèíèöà àêòèâíîñòè

ÈÏÒÃ èçîïðîïèëòèîãàëàêòîçèä

ÒÅÌÅÄ N,N,N,'N'-òåòðàìåòèë-ýòèëåí-äèàìèí

òðèñ òðèñ(ãèäðîêñèìåòèë)àìèíîìåòàí

äÍTÔ äåçîêñèàäåíîçèíòðèôîñôàò

ääÍÒÔ äèäåçîêñèíåêëåîòèäòðèôîñôàò

äÍÒÔ äåçîêñèíóêëåîòèäòðèôîñôàò

ðATÔ ðèáîàäåíîçèíòðèôîñôàò

ÄÒÒ äèòèîòðåéòîë

Na2ÝÄÒÀ ýòèëåíäèàìèíòåòðààöåòàò íàòðèÿ

SDS äîäåöèëñóëüôàò íàòðèÿ

X-Gal 5-áðîìî-4-õëîðî-3-èíäîëèë-áåòà-D-ãàëàêòîçèä

ÂÂÅÄÅÍÈÅ

 îñíîâå ôóíêöèîíèðîâàíèÿ ãóìîðàëüíîãî èììóíèòåòà ó ìëåêîïèòàþùèõ ëåæèò ñëîæíûé êîìïëåêñ ìîëåêóëÿðíî-ãåíåòè÷åñêèõ è ôèçèîëîãè÷åñêèõ ìåõàíèçìîâ, îáåñïå÷èâàþùèõ ðåîðãàíèçàöèþ, ìóòàãåíåç è êëîíàëüíóþ ýêñïðåññèþ ãåíîâ èììóíîãëîáóëèíîâ. Âîçíèêíîâåíèå ýòîé ïîäñèñòåìû èììóíèòåòà ñâÿçûâàþò ñ ïîÿâëåíèåì õðÿùåâûõ ðûá.

Íà ðàííèõ ýòàïàõ ýâîëþöèè ãåíû Èà áûëè îðãàíèçîâàíû â âèäå ïîâòîðÿþùèõñÿ êëàñòåðîâ V-J-C ãåííûõ ñåãìåíòîâ. Ïðè ïîäîáíîé îðãàíèçàöèè ðàçíîîáðàçèå ïðîäóöèðóåìûõ àíòèòåë îñíîâûâàëîñü, ïðåæäå âñåãî, íà êîëè÷åñòâå èìåâøèõñÿ â ãåíîìå êëàñòåðîâ, êàæäûé èç êîòîðûõ êîäèðîâàë îäèí âàðèàíò ïîëèïåïòèäíûõ ñóáúåäèíèö ÈÃ.  õîäå äàëüíåéøåé ýâîëþöèè ïðîèçîøåë ïåðåõîä îò êëàñòåðíîé ê ñåãìåíòàðíîé îðãàíèçàöèè, îáåñïå÷èâàþùåé äîïîëíèòåëüíûé èñòî÷íèê ðàçíîîáðàçèÿ çà ñ÷åò êîìáèíàòèâíîé ðåêîìáèíàöèè ãåííûõ ñåãìåíòîâ. Ïðåäïîëàãàåòñÿ, ÷òî ýòîò ïåðåõîä òàêæå èìåë âàæíîå çíà÷åíèå äëÿ ðåãóëÿöèè ýêñïðåññèè ãåíîâ è îñóùåñòâëåíèÿ ìåõàíèçìîâ êëîíàëüíîãî îòáîðà àíòèòåëîïðîäóöèðóþùèõ êëåòîê â õîäå èììóííîãî îòâåòà.

Íàñòîÿùàÿ ðàáîòà ïðåäñòàâëÿåò ñîáîé ÷àñòü ïðîåêòà, íàïðàâëåííîãî íà èçó÷åíèå ýâîëþöèè ìåõàíèçìîâ èçîòèïè÷åñêîãî èñêëþ÷åíèÿ ãåíîâ ëåãêèõ öåïåé Èà ó íèçøèõ ïîçâîíî÷íûõ. Öåëÿìè ðàáîòû ÿâëÿëèñü èçó÷åíèå ñòðóêòóðû è îðãàíèçàöèè ãåíîâ ëåãêèõ öåïåé Èà ñòåðëÿäè (Acipenser ruthenus), ïðåäñòàâèòåëÿ ôèëîãåíåòè÷åñêè äðåâíåé ãðóïïû êîñòíî-õðÿùåâûõ ðûá.

ÎÁÇÎÐ ËÈÒÅÐÀÒÓÐÛ

ÑÒÐÎÅÍÈÅ ÈÌÌÓÍÎÃËÎÁÓËÈÍÎÂ

Èììóíîãëîáóëèíû âûïîëíÿþò â îðãàíèçìå ïîçâîíî÷íûõ ôóíêöèþ ãóìîðàëüíûõ àíòèòåë è àíòèãåí-ñâÿçûâàþùèõ ðåöåïòîðîâ Â-ëèìôîöèòîâ. Îñîáåííîñòüþ ýòîãî êëàññà áåëêîâ ÿâëÿåòñÿ îãðîìíîå ðàçíîîáðàçèå, ïîçâîëÿþùåå èì âñòóïàòü âî âçàèìîäåéñòâèå ñ ôàêòè÷åñêè ëþáûìè áèîëîãè÷åñêèìè ìàêðîìîëåêóëàìè.

Òèïè÷íàÿ ìîëåêóëà Èà ñîñòîèò èç äâóõ èäåíòè÷íûõ òÿæåëûõ (H) è äâóõ èäåíòè÷íûõ ëåãêèõ (L) ïîëèïåïòèäíûõ öåïåé. H- è L-öåïè ïîñòðîåíû èç íåñêîëüêèõ äîìåíîâ, êàæäûé èç êîòîðûõ ñîñòîèò ïðèìåðíî èç 110 àìèíîêèñëîòíûõ îñòàòêîâ. Ó ìëåêîïèòàþùèõ ñóùåñòâóåò ïÿòü êëàññîâ H-öåïåé: g, m, a, d, è e. Êàæäàÿ H-öåïü ïîñòðîåíà èç îäíîãî N-êîíöåâîãî è íåñêîëüêèõ (òðåõ èëè ÷åòûðåõ) C-êîíöåâûõ äîìåíîâ. N-êîíöåâûå äîìåíû ðàçëè÷àþòñÿ â ðàçíûõ ìîëåêóëàõ è íàçûâàþòñÿ âàðèàáåëüíûìè (V) äîìåíàìè. C-êîíöåâûå äîìåíû èìåþò îäèíàêîâóþ ñòðóêòóðó ó ìîëåêóë îäíîãî êëàññà è íàçûâàþòñÿ êîíñòàíòíûìè (Ñ) äîìåíàìè (ðèñ. 1) (Ïîë, 1987).

Ñðåäè L-öåïåé ìëåêîïèòàþùèõ ðàçëè÷àþò äâà òèïà: ëÿìáäà è êàïïà. Êàæäàÿ L-öåïü ñîñòîèò èç îäíîãî âàðèàáåëüíîãî è îäíîãî êîíñòàíòíîãî äîìåíîâ.  èíäèâèäóàëüíîé ìîëåêóëå Èà ïðèñóòñòâóåò òîëüêî îäèí òèï L-öåïè (Roitt et al., 1993).

Ãèãàíòñêîå ðàçíîîáðàçèå Èà îáåñïå÷èâàåòñÿ ïðåæäå âñåãî òåì, ÷òî V è C îáëàñòè êîäèðóþòñÿ ðàçíûìè ãåíàìè (ãåííûìè ñåãìåíòàìè), ôèçè÷åñêè ðàçíåñåííûìè â çàðîäûøåâîé ÄÍÊ.

 ôîðìèðîâàíèè âàðèàáåëüíûõ äîìåíîâ H-öåïåé ó÷àñòâóþò òðè ãåííûõ ñåãìåíòà: âàðèàáåëüíûé (V), D-ñåãìåíò (îò àíãë. diversity- ðàçíîîáðàçèå) è J-ñåãìåíò (îò àíãë. joining- ñîåäèíÿþùèé). Ñ-îáëàñòè Í-öåïåé ðàçíûõ êëàññîâ êîäèðóþòñÿ îòäåëüíûìè ãåíàìè (Roitt et al., 1993).










Ðèñ. 1. Ñõåìà ñòðîåíèÿ ìîëåêóëû èììóíîãëîáóëèíà.

Òèïè÷íàÿ ìîëåêóëà èììóíîãëîáóëèíà ñîäåðæèò äâå èäåíòè÷íûå ëåãêèå (L) è äâå èäåíòè÷íûå òÿæåëûå (H) öåïè, ñâÿçàííûå ìåæäó ñîáîé êîâàëåíòíî äèñóëüôèäíûìè ñâÿçÿìè. Êàæäàÿ L-öåïü ñîñòîèò èç îäíîãî âàðèàáåëüíîãî (VL) è îäíîãî êîíñòàíòíîãî (ÑL) äîìåíà. Í-öåïü ñîñòîèò èç îäíîãî VH è íåñêîëüêèõ CÍ äîìåíîâ.

 ôîðìèðîâàíèè çðåëîãî ãåíà L-öåïè ó÷àñòâóþò òðè ãåííûõ ñåãìåíòà: V-ñåãìåíò è J-ñåãìåíò êîäèðóþò V-äîìåí, C-ñåãìåíò êîäèðóåò êîíñòàíòíûé äîìåí. Íà ïîçäíèõ ñòàäèÿõ ðàçâèòèÿ Â-ëèìôîöèòà ãåííûå ñåãìåíòû, êîäèðóþùèå âàðèàáåëüíûå äîìåíû, îáúåäèíÿþòñÿ â ðàçëè÷íûõ ñî÷åòàíèÿõ, îáðàçóÿ ìàòðèöó äëÿ ýêñïðåññèè L- è H-öåïåé (Seidman et al., 1979; Durdik et al., 1984).

ÃÅÍÎÌÍÀß ÎÐÃÀÍÈÇÀÖÈß È ÝÊÑÏÐÅÑÑÈß ÃÅÍÎÂ L-ÖÅÏÅÉ ÈÃ Ó ÌËÅÊÎÏÈÒÀÞÙÈÕ

Ðàçëè÷íûå âèäû ìëåêîïèòàþùèõ èìåþò ñõîäíóþ ñõåìó îðãàíèçàöèè è ýêñïðåññèè ãåíîâ ÈÃ. Îäíèì èç íàèáîëåå èçó÷åííûõ â ýòîì îòíîøåíèè âèäîâ ÿâëÿåòñÿ ÷åëîâåê. Ëÿìáäà è êàïïà öåïè Èà ó ÷åëîâåêà êîäèðóþòñÿ ãåíàìè, ðàñïîëîæåíûìè â ðàçíûõ ëîêóñàõ è íà ðàçíûõ õðîìîñîìàõ. Êàïïà ëîêóñ ñîñòîèò èç áîëüøîãî êîëè÷åñòâà Vk ãåííûõ ñåãìåíòîâ, ñîáðàíûõ â ãðóïïû, ïÿòè Jk è îäíîãî Ñk ñåãìåíòà.. Òàêîé òèï îðãàíèçàöèè íàçûâàåòñÿ ñåãìåíòàðíûì (ðèñ. 2). Ëÿìáäà ëîêóñ ñîñòîèò èç ãðóïïû Vl ñåãìåíòîâ, òî÷íîå êîëè÷åñòâî êîòîðûõ íåèçâåñòíî, è ñåìè ïàð Jl-Cl ñåãìåíòîâ. Òðè èç íèõ (JCl4 - JCl6) ÿâëÿþòñÿ ïñåâäîãåíàìè (Hieter et al., 1981; Roitt et al., 1993).

 ïðîöåññå ðàçâèòèÿ Â-ëèìôîöèòà â êðîâåòâîðíûõ îðãàíàõ îäèí èç V ñåãìåíòîâ ñîåäèíÿåòñÿ ñ îäíèì èç J ñåãìåíòîâ ïîñðåäñòâîì ñàéòñïåöèôè÷åñêîé ðåêîìáèíàöèè (Schatz et al., 1992).  ýòîò ïðîöåññ âîâëåêàþòñÿ ñïåöèàëüíûå îëèãîìåðíûå ïîñëåäîâàòåëüíîñòè: ãåïòà- è íîíàìåðû, ôëàíêèðóþùèå ñ 3' ñòîðîíû V ñåãìåíò è ñ 5' ñòîðîíû J ñåãìåíò (ðèñ. 3) (Aguilera et al., 1987; Hesse et al., 1989). Îòëè÷èòåëüíîé îñîáåííîñòüþ ëÿìáäà è êàïïà ëîêóñîâ ÿâëÿåòñÿ êîíôèãóðàöèÿ ïðîìåæóòêîâ ìåæäó ãåïòà- è íîíàìåðàìè, íàçûâàåìûõ ñïåéñåðàìè. Ñ V è J ãåííûìè ñåãìåíòàìè ëÿìáäà òèïà àññîöèèðîâàíû 23 ïí è 12 ïí ñïåéñåðû ñîîòâåòñòâåííî, à ñ V è J ñåãìåíòàìè êàïïà òèïà - 12 ïí è 23 ïí ñïåéñåðû (Durdik et al., 1984; Stavnezer et al., 1985).

ë

Ðèñ. 2. Ñõåìà ñòðîåíèÿ ëÿìáäà è êàïïà ëîêóñîâ ãåíîâ L-öåïåé Èà ÷åëîâåêà.

Ëÿìáäà ëîêóñ ñîäåðæèò ìíîãî Vl ñåãìåíòîâ è ñåìü ïàð áëèçêîðàñïîëîæåííûõ Jl-Cl. Òðè èç íèõ ÿëÿþñÿ ïñåâäîãåíàìè (Y). Êàïïà ëîêóñ ñîäåðæèò ìíîãî Vk ïÿòü Jk è îäèí Ck ãåííûé ñåãìåíò (Hieter et al., 1981; Roitt et al., 1993).

Îáîçíà÷åíèÿ: - ñèãíàëüíûå îëèãîìåðû.

Ðèñ. 3. Ñõåìà ðàñïîëîæåíèÿ îëèãîíóêëåîòèäíûõ ïîñëåäîâàòåëüíîñòåé, çàäåéñòâîâàííûõ â ñàéòñïåöèôè÷åñêîé ðåêîìáèíàöèè â êàïïà ëîêóñå ìëåêîïèòàþùèõ. Ýòè ïîñëåäîâàòåëüíîñòè ôëàíêèðóþò ñ 3‘ ñòîðîíû VL ñåãìåíò è ñ 5’ ñòîðîíû JL ñåãìåíò. Âî âðåìÿ ðåêîìáèíàöèè ãåïòàìåð è íîíàìåð îäíîãî èç VL ñåãìåíòà îáúåäèíÿþòñÿ ñ ãåïòàìåðîì è íîíàìåðîì îäíîãî èç JL ñåãìåíòà. Ýòî äåëàåò âîçìîæíûì ñîåäèíåíèå VL è JL ñåãìåíòîâ áåç íàðóøåíèÿ ðàìêè òðàíñëÿöèè (Aguilera et al., 1987; Hesse et al., 1989).

Îáîçíà÷åíèÿ: - ñèãíàëüíûå îëèãîìåðû.

Ïîñëåäîâàòåëüíîñòü, â êîòîðîé ðåêîìáèíèðóþò ëîêóñû L-öåïåé, ñòðîãî óïîðÿäî÷åíà âî âðåìåíè. Ïîêàçàíî, ÷òî ïåðâûìè ïåðåñòðàèâàþòñÿ ëîêóñû êàïïà òèïà, ïðè÷åì åñëè â îäíîé õðîìîñîìå ïåðåñòðîéêà îêàçàëàñü íåôóíêöèîíàëüíîé, òîåñòü íå ïðèâåëà ê ïîÿâëåíèþ ïîëíîöåííîãî ãåíà, òî ðåêîìáèíàöèÿ ïðîèñõîäèò â êàïïà ëîêóñå íà ãîìîëîãè÷íîé õðîìîñîìå.  ñëó÷àå ïîâòîðíîé àáîðòèâíîé ïåðåñòðîéêè àíàëîãè÷íî ïðîèñõîäÿò ïåðåñòðîéêè â ëÿìáäà ëîêóñàõ. Åñëè â êëåòêå íåïðîäóêòèâíî ïåðåñòðîèëèñü âñå ÷åòûðå ëîêóñà, òî îíà ïðåâðàùàòñÿ â 0-êëåòêó è ïîäâåðãàåòñÿ àïîïòîçó. Åñëè æå ïåðåñòðîéêà îäíîãî èç ëîêóñîâ ïðèâåëà ê îáðàçîâàíèþ ôóíêöèîíàëüíîãî ãåíà, òî ðåêîìáèíàöèÿ îñòàëüíûõ ëîêóñîâ áëîêèðóåòñÿ. Äåòàëè ìåõàíèçìà áëîêèðîâàíèÿ íåèçâåñòíû, îäíàêî óñòàíîâëåíî, ÷òî íåîáõîäèìûì óñëîâèåì äëÿ íåãî ÿâëÿåòñÿ òðàíñêðèïöèÿ ïðîäóêòèâíî ïåðåñòðîåííîãî ãåíà.  ðåçóëüòàòå â êàæäîì èíäèâèäóàëüíîì ëèìôîöèòå ñèíòåçèðóåòñÿ òîëüêî îäèí òèï L-öåïåé, êàïïà èëè ëÿìáäà, è ýêñïðåññèÿ ãåíà ïðîèñõîäèò òîëüêî íà îäíîé èç äâóõ ãîìîëîãè÷íûõ õðîìîñîì. Ýòè ôåíîìåíû, íàçûâàåìûå èçîòèïè÷åñêèì è àëëåëüíûì èñêëþ÷åíèÿìè ëåæàò â îñíîâå êëþ÷åâîãî ïðèíöèïà ôóíêöèîíèðîâàíèÿ èììóííîé ñèñòåìû - ïðèíöèïà êëîíàëüíîé ñåëåêöèè (Ïîë, 1987; Strob, 1987).

 îðãàíèçìå ìëåêîïèòàþùèõ ãåíåðèðóåòñÿ ñâûøå äåñÿòè ìèëëèîíîâ âàðèàíòîâ àíòèòåë, õîòÿ â ãåíîìå ñîäåðæèòñÿ çíà÷èòåëüíî ìåíüøåå êîëè÷åñòâî ãåííûõ ñåãìåíòîâ, êîòîðûå ìîãóò ó÷àñòâîâàòü â ôîðìèðîâàíèè âàðèàáåëüíûõ äîìåíîâ.  ñëó÷àå L-öåïåé, îñíîâíûì èñòî÷íèêîì ðàçíîîáðàçèÿ ÿâëÿåòñÿ êîìáèíàòèâíîå ñî÷åòàíèå V è J ñåãìåíòîâ. Äîïîëíèòåëüíûì èñòî÷íèêîì ÿâëÿåòñÿ ñìåùåíèå ðåêîìáèíàöèîííîé ðàìêè â ìåñòå èõ ñîåäèíåíèÿ. Êðîìå òîãî, V ãåííûå ñåãìåíòû ìîãóò îáìåíèâàòüñÿ ó÷àñòêàìè ÄÍÊ ñ ïñåâäîãåíàìè ïîñðåäñòâîì ãåííîé êîíâåðñèè. Î÷åíü ñóùåñòâåííûé âêëàä â ðàçíîîáðàçèå ñïåöèôè÷íîñòåé àíòèòåë âíîñèò ñîìàòè÷åñêîå ìóòèðîâàíèå âàðèàáåëüíûõ ãåííûõ ñåãìåíòîâ â ñàéòàõ, ó÷àñòâóþùèõ â ôîðìèðîâàíèè àíòèãåíñâÿçûâàþùåãî öåíòðà. Ñîìàòè÷åñêîå ðàçíîîáðàçèå ãåíåðèðóåòñÿ ïðè âòîðè÷íîì èììóííîì îòâåòå ïóòåì âêëþ÷åíèÿ ãèïåðìóòàöèîííîãî ìåõàíèçìà â êëåòêàõ ïàìÿòè â çàðîäûøåâûõ öåíòðàõ ëèìôàòè÷åñêèõ óçëîâ (Tonegawa 1983; Roitt et al., 1993).

ÃÅÍÎÌÍÀß ÎÐÃÀÍÈÇÀÖÈß È ÝÊÑÏÐÅÑÑÈß ÃÅÍΠL-ÖÅÏÅÉ ÈÃ Ó ÍÈÇØÈÕ ÏÎÇÂÎÍÎ×ÍÛÕ

Õðÿùåâûå ðûáû.

Ãóìîðàëüíûé èììóííûé îòâåò â âèäå ñïåöèôè÷åñêèõ àíòèòåë îáíàðóæèâàåòñÿ òîëüêî ó ïîçâîíî÷íûõ. Íàèáîëåå ïðèìèòèâíûìè âèäàìè, ó êîòîðûõ îáíàðóæåíà ñïîñîáíîñòü ñèíòåçèðîâàòü ÈÃ, ÿâëÿþòñÿ õðÿùåâûå ðûáû. Ïðåäñòàâèòåëè òðåõ îñíîâíûõ òàêñîíîâ (àêóëû, ñêàòû è õèìåðû) ïðîäóöèðóþò àíòèòåëà â îòâåò íà ââåäåíèå øèðîêîãî ñïåêòðà àíòèãåíîâ. Îäíàêî, â îòëè÷èå îò ìëåêîïèòàþùèõ, ãåòåðîãåííîñòü ñûâîðîòî÷íûõ àíòèòåë ó õðÿùåâûõ ðûá âûðàæåíà î÷åíü ñëàáî. Êðîìå òîãî, ó íèõ íå îáíàðóæåíî ñîçðåâàíèå èììóííîãî îòâåòà - ïðè âòîðè÷íîì ââåäåíèè àíòèãåíà ñïåêòð àíòèòåë íå ìåíÿåòñÿ (Flajnik, 1996). Ðåçóëüòàòû èññëåäîâàíèé ïîñëåäíèõ ëåò ïðîäåìîíñòðèðîâàëè, ÷òî îðãàíèçàöèÿ ãåíîâ Èà ó õðÿùåâûõ ðûá òàêæå èìååò ÿðêî âûðàæåííûå îñîáåííîñòè.

Ó õðÿùåâûõ ðûá îáíàðóæåíû ãåíû òðåõ òèïîâ L-öåïåé, ëîêàëèçóþùèåñÿ â ðàçíûõ ëîêóñàõ. Â êàæäîì ëîêóñå ãåíûå ñåãìåíòû îðãàíèçîâàíû â êëàñòåðû, èìåþùèå ïî îäíîìó V, J è C ãåííîìó ñåãìåíòó (ðèñ. 4). Òàêèõ êëàñòåðîâ ñîäåðæèòñÿ íåñêîëüêî äåñÿòêîâ èëè äàæå ñîòåí â îäíîì ëîêóñå íà ðàññòîÿíèè 12-15 òïí äðóã îò äðóãà (Rast et al., 1994).

Ãåíû ïåðâîãî òèïà íàéäåíû ó ðàçíîçóáîé àêóëû (Heterodontus francisci) (Shamblott and Litman, 1989) è ìàëîãî ñêàòà (Raja erinacea) (Anderson et al., 1995). Ó àêóëû êëàñòåðû èìåþò ðàçìåð 3-6 òïí. V è J, J è C ãåííûå ñåãìåíòû ðàçäåëåíû ïðèìåðíî 0,5 è 4 òïí ñîîòâåòñòâåííî. Ó ñêàòà V è J ñåãìåíòû ñëèòû â çàðîäûøåâîé ÄÍÊ.

Ãåíû âòîðîãî òèïà îáíàðóæåíû ó ïÿòíèñòîé õèìåðû (Hydrolagus colliei) (Maisey, 1984), ïåñ÷àíîé àêóëû (Carcharhinus plumbeus) (Hohman et al., 1992; Hohman et al., 1993), ðàçíîçóáîé àêóëû è ìàëîãî ñêàòà (Ó âñåõ èçó÷åííûõ âèäîâ â êëàñòåðàõ ýòîãî òèïà V è J ãåííûå ñåãìåíòû ñîåäèíåíû óæå â çàðîäûøåâîì ãåíîìå. V è C ãeííûå ñåãìåíòû ðàçäåëåíû 2-3 òïí.

Ðèñ. 4. Ñõåìà ñòðîåíèÿ ëîêóñîâ ãåíîâ L-öåïåé ÈÃ ó àêóëû.

Îðãàíèçàöèÿ ãåíîâ ó àêóëû èìååò êëàñòåðíûé òèï. Êàæäûé êëàñòåð èìååò ðàçìåð 3 - 6 òïí è ñîäåðæèò ïî îäíîìó VL, JL è CL ãåííîìó ñåãìåíòó.

Îáíàðóæåíî òðè òèïà ãåíîâ L-öåïåé ÈÃ. Ëîêóñû ãåíîâ ïåðâîãî è òðåòüåãî òèïîâ èìåþò ñõîæóþ îðãàíèçàöèþ.  ýòîì ñëó÷àå VL è JL, JL è CL ñåãìåíòû ðàçäåëåíû ïðèìåðíî 0,5 è 4 òïí ñîîòâåòñòâåííî (À) (Rast et al., 1994).

 ëîêóñå ãåíîâ âòîðîãî òèïà VL è JL ñåãìåíòû ñîåäèíåíû óæå â çàðîäûøåâîì ãåíîìå (Á).

Òðåòèé òèï ãåíîâ L-öåïåé íàéäåí ó àêóëû-íÿíüêè (Gynglimostoma cirratum) (Greenberg et al., 1993) è ðàçíîçóáîé àêóëû (Rast et al., 1994).  êëàñòåðàõ ýòîãî òèïà V è J, J è C ãåííûå ñåãìåíòû ðàçäåëåíû, êàê è â êëàñòåðàõ ïåðâîãî òèïà, ïðèìåðíî 0,5 è 4 òïí ñîîòâåòñòâåííî. V è J ãåííûå ñåãìåíòû ôëàíêèðóþòñÿ ñàéòàìè ñïåöèôè÷åñêîé ðåêîìáèíàöèè ñî ñïåéñåðàìè 12 è 23 ïí, ÷òî ñîîòâåòñòâóåò êîíôèãóðàöèè ñïåéñåðîâ â ëîêóñàõ êàïïà òèïà ìëåêîïèòàþùèõ. Ïî ïåðâè÷íîé ñòðóêòóðå ãåíû òðåòüåãî òèïà òîæå íàèáîëåå áëèçêè ê ãåíàì êàïïà òèïà âûñøèõ ïîçâîíî÷íûõ (ãîìîëîãèÿ ïî àìèíîêèñëîòíîé ïîñëåäîâàòåëüíîñòè ñîñòàâëÿåò îêîëî 60%).

Ãåíû ýòèõ òðåõ òèïîâ èìåþò ìåæäó ñîáîé íèçêóþ ñòåïåíü ãîìîëîãèè:40-50% ïî íóêëåîòèäíîé ïîñëåäîâàòåëüíîñòè Ñ ñåãìåíòîâ è 50-60% ïî ïîñëåäîâàòåëüíîñòè V ñåãìåíòîâ (Hohman et al., 1993).

Ïîëó÷åííûå äàííûå ïîêàçûâàþò, ÷òî ó õðÿùåâûõ ðûá èìååòñÿ î÷åíü áîëüøîå êîëè÷åñòâî ãåííûõ ñåãìåíòîâ. Îäíàêî ñïåöèôèêà îðãàíèçàöèè ãåíîâ èñêëþ÷àåò êîìáèíàòèâíîå ñî÷åòàíèå ñåãìåíòîâ. Âñå ðàçíîîáðàçèå àíòèòåë ó õðÿùåâûõ ðûá ôîðìèðóåòñÿ òîëüêî çà ñ÷åò ýêñïðåññèè áîëüøîãî êîëè÷åñòâà êëàñòåðîâ.

Äàííûå î íóêëåîòèäíûõ ïîñëåäîâàòåëüíîñòÿõ èç ðàçíûõ ëîêóñîâ âûÿâèëè íèçêóþ ãåòåðîãåííîñòü ãåíîâ (85-95%), ÷òî óêàçûâàåò íà îòñóòñòâèå ñîìàòè÷åñêîãî ìóòàãåíåçà (Rast et al., 1994).

Êîñòèñòûå ðûáû.

Àíàëèç ñûâîðîòî÷íûõ àíòèòåë ïåùåðíîãî ñîìèêà (Ictalurus punctatus) ïîêàçàë íàëè÷èå òðåõ òèïîâ L-öåïåé ñ ðàçëè÷íûìè ìîëåêóëÿðíûìè ìàññàìè: 26, 24 è 22 êÄà. Äâà âèäà àíòèòåë ìûøè, 3F12 è 1G7, çàõâàòûâàþò áîëåå 90% îò îáùåãî êîëè÷åñòâà èììóíîãëîáóëèíîâ â ðåàêöèè èììóíîïðåöèïèòàöèè. Ïðè ýòîì 3F12 àíòèòåëà ñâÿçûâàþòñÿ ñ ìîëåêóëàìè, ñîäåðæàùèìè L-öåïè ìàññîé 24 è 22 êÄà, à 1G3 àíòèòåëà ñ äðóãîé ñóáïîïóëÿöèåé, ñîäåðæàùåé L-öåïè ìàññîé 26 êÄà. Íà îñíîâå ýòèõ äàííûõ L-öåïè ðàçäåëÿþò íà äâà êëàññà, íàçûâàåìûå F è G (Lobb et al.,1984).

Ãåíîìíàÿ îðãàíèçàöèÿ ëîêóñà L-öåïåé G òèïà èìååò êëàñòåðíûé òèï (ðèñ. 5). Â êàæäîì êëàñòåðå ñîäåðæèòñÿ ïî îäíîìó J è C ñåãìåíòó è äâà V ñåãìåíà. Âàðèàáåëüíûå ãåííûå ñåãìåíòû ðàñïîëîæåíû âñåãäà â ïðîòèâîïîëîæíîé òðàíñêðèïöèîííîé ïîëÿðíîñòè ê J è C ñåãìåíòàì . Â ðÿäå ãåíîìíûõ êëîíîâ îäèí V ñåãìåíò ðàñïîëàãàëñÿ ñ 3' ñòîðîíû îò C ãåííîãî ñåãìåíòà. Ðàçìåð êëàñòåðà ðàâåí ïðèìåðíî 3 òïí, ðàññòîÿíèå ìåæäó êëàñòåðàìè îêîëî 6 òïí (Ghaffari and Lobb, 1993; Bengten, 1994).

Õîòÿ ãåíû L-öåïåé ñîìèêà èìåþò íèçêóþ ãîìîëîãèþ ñ ãåíàìè äðóãèõ ïîçâîíî÷íûõ (40-50% ïî íóêëåîòèäíîé ïîñëåäîâàòåëüíîñòè), èõ ìîæíî îòíåñòè ê êàïïà òèïó âûñøèõ ïîçâîíî÷íûõ, òàê êàê ñõîäñòâî ïî ïåðâè÷íîé ñòðóêòóðå ñ ëÿìáäà òèïîì íèæå. Êðîìå òîãî, êîíôèãóðàöèÿ ñïåéñåðîâ èìååò õàðàêòåð êàïïà òèïà: 12 ïí ñïåéñåð àññîöèèðîâàí ñ V, 23 ïí ñïåéñåð ñ J ñåãìåíòîì (Ghaffari and Lobb, 1993).

Ó ðàäóæíîé ôîðåëè (Oncorhynchus mykiss), ïðåäñòàâèòåëÿ äðóãîãî ñåìåéñòâà êîñòèñòûõ ðûá, òàêæå îáíàðóæåíû äâà òèïà L öåïåé (Daggfeldt et al., 1993). Îäèí èç íèõ (L1) âûñîêîãîìîëîãè÷åí G òèïó ñîìèêà ïî ñòðóêòóðå V è C îáëàñòåé è ñîîòâåòñòâóþùèé ëîêóñ èìååò ñõîäíóþ îðãàíèçàöèþ.

Ïî-âèäèìîìó, ó ýòèõ âèäîâ îáúåäèíåíèå V è J ñåãìåíòîâ ïðîèñõîäèò òîëüêî çà ñ÷åò èíâåðñèé ñ âîññòàíîâëåíèåì åäèíîé ïîëÿðíîñòè òðàíñêðèïöèè. Ðàçíîîáðàçèå âàðèàáåëüíûõ äîìåíîâ îáðàçóåòñÿ â ðåçóëüòàòå êîìáèíàòèâíîãî ñî÷åòàíèÿ V è J ñåãìåíòîâ â ïðåäåëàõ îäíîãî êëàñòåðà. Íå èñêëþ÷àåòñÿ, ÷òî â ïåðåñòðîéêè ìîãóò âîâëåêàòüñÿ è ñîñåäíèå êëàñòåðû.

Èíòåðåñíîé îñîáåííîñòüþ êîñòèñòûõ ðûá ÿâëÿåòñÿ î÷åíü âûñîêàÿ ïðîïîðöèÿ ìÐÍÊ, ïðåäñòàâëÿþùåé òàê íàçûâàåìûå ñòåðèëüíûå òðàíñêðèïòû (Ghaffari and Lobb, 1993). Ýòè òðàíñêðèïòû âêëþ÷àþò â ñåáÿ òîëüêî Ñ-ñåãìåíòû è ôëàíêèðóþùèå èõ 5’è 3’-íåòðàíñëèðóåìûå ó÷àñòêè. Êîëè÷åñòâî ñòåðèëüíûõ òðàíñêðèïòîâ ó ñîìèêà è ôîðåëè â 5 ðàç ïðåâûøàåò êîëè÷åñòâî ïîëíûõ VJC-òðàíñêðèïòîâ.

Ðèñ. 5. Ãåíîìíàÿ îðãàíèçàöèÿ ëîêóñà ãåíîâ L-öåïåé ÈÃ ó ïåùåðíîãî ñîìèêà.

Ãåííûå ñåãìåíòû îðãàíèçîâàíû â êëàñòåðû. Êàæäûé êëàñòåð ñîäåðæèò äâà VL è ïî îäíîìó JL è CL ñåãìåíòó è èìååò ðàçìåð îêîëî 5 òïí. Ðàññòîÿíèå ìåæäó JL è CL îêîëî 1000 ïí, VL ñåãìåíòû óäàëåíû îò 5' êîíöà JL ñåãìåíòà íà 3 òïí. VL ñåãìåíòû âñåãäà ðàñïîëîæåíû â ïðîòèâîïîëîæíîé òðàíñêðèïöèîííîé ïîëÿðíîñòè ïî îòíîøåíèþ JL è CL ñåãìåíòàì (Ghaffari and Lobb, 1993).

Àìôèáèè.

Ó øïîðöåâîé ëÿãóøêè (Xenopus laevis) âûÿâëåíî òðè ñåìåéñòâà ãåíîâ L-öåïåé ÈÃ, êîäèðóþùèõ òðè ðàçëè÷íûõ èçîòèïà: L1 (ðî), L2 (ñèãìà) è L3 (ðèñ. 6).

Âñå òðè ëîêóñà èìåþò ñåãìåíòàðíûé õàðàêòåð îðãàíèçàöèè. L1 ëîêóñ ñîäåðæèò ìíîæåñòâåííûå VL1 ñåãìåíòû, ðàçäåëåííûå â ãåíîìå 2.1 - 3.6 òïí, ïÿòü JL1 ñåãìåíòîâ, òðè èç êîòîðûõ èäåíòè÷íû, è îäèí CL1 ãåííûé ñåãìåíò (Stewart et al., 1993). JL1 è VL1 ñåãìåíòû ôëàíêèðóþòñÿ êàíîíè÷åñêèìè ãåïòà- è íîíàìåðíûìè ñèãíàëüíûìè ïîñëåäîâàòåëüíîñòÿìè, ðàçäåëåííûìè 12 ïí ó VL1 è 23 ïí ó JL1 ñåãìåíòîâ (Sakano et al., 1980).

Ëîêóñ ãåíîâ âòîðîãî òèïà ðàçäåëÿåòñÿ íà äâà ñåìåéñòâà, s1 è s2, êîòîðûå â ãåíîìå ðàñïîëàãàþòñÿ îòäåëüíî. Ãåíîì ëÿãóøêè ñîäåðæèò ìíîæåñòâåííûå Vs1 è íåñêîëüêî Vs2 ãåíûõ ñåãìåíòîâ, îäíó ïàðó Js1-Cs1 è ïàðó Js2-Cs2 (Schwager et al., 1991). Ðàñïîëîæåíèå ãåíîâ ýòîãî òèïà äðóã îòíîñèòåëüíî äðóãà òî÷íî íå îïðåäåëåíî.

Íåäàâíî áûë îáíàðóæåí òðåòèé òèï ãåíîâ L-öåïåé ó ëÿãóøêè.  ãåíîìå ëÿãóøêè ñîäåðæèòñÿ øåñòü ñåìåéñòâ V ñåãìåíòîâ ýòîãî òèïà. Îáùåå êîëè÷åñòâî VL3 ýëåìåíòîâ ñîñòàâëÿåò ïî ìåíüøåé ìåðå 30 êîïèé. Êàæäûé VL3 ýëåìåíò ìîæåò ðåêîìáèíèðîâàòü ñ îäíîé èç äâóõ ïàð JCL3 ãåííûõ ñåãìåíòîâ (Haire et al., 1996).

Ãåíû òðåõ òèïîâ çíà÷èòåëüíî ðàçëè÷àþòñÿ: ãîìîëîãèÿ íà àìèíîêèñëîòíîì óðîâíå ñîñòàâëÿåò ïðèáëèçèòåëüíî 30% (Zezza et al., 1991).  òî æå âðåìÿ, ðÿä ïðèçíàêîâ ïîçâîëÿåò ñîîòíåñòè ãåíû L1 è L3 òèïà ñ êàïïà è ëÿìáäà òèïàìè ìëåêîïèòàþùèõ.

Ñåìåéñòâî ãåíîâ ïåðâîãî òèïà ìîæíî îòíåñòè ê êàïïà òèïó ïî íåñêîëüêèì ïðè÷èíàì (Zezza et al., 1992): à) âûñîêàÿ ãîìîëîãèÿ ïåðâè÷íîé ñòðóêòóðû (áîëåå 50%); á) ñóùåñòâåííîå ñõîäñòâî ãåíîìíîé îðãàíèçàöèè ëîêóñà (ìíîãî VL1 è îäèí CL1 ãåííûé ñåãìåíò); â) êîôèãóðàöèÿ ñïåéñåðîâ ìåæäó ãåïòà- è íîíàìåðûìè ñîîòâåòñòâóåò êàïïà òèïó; ã) JL1 è CL1 ãåííûå ñåãìåíòû ðàçäåëåíû ïðèìåðíî 3.5 òïí, ÷òî ïðèáëèçèòåëüíî ðàâíî ðàññòîÿíèþ ìåæäó JLk è CLk ýëåìåíòàìè ÷åëîâåêà (Sakano et al., 1979; Hieter et al., 1982) è çíà÷èòåëüíî áîëüøå ÷åì ðàññòîÿíèå ìåæäó JLl è CLl ìëåêîïèòàþùèõ (Blomberg et al., 1982; Udey, 1987).

Ðèñ. 6. Ãåíîìíàÿ îðãàíèçàöèÿ ëîêóñà ïåðâîãî è òðåòüåãî òèïîâ ãåíîâ L-öåïåé ÈÃ ó øïîðöåâîé ëÿãóøêè.

Ëîêóñ ñåìåéñòâà L1 ñîäåðæèò ìíîæåñòâåííûå VL1 ñåãìåíòû, ïÿòü JL1 ñåãìåíòîâ îäèí CL1 ãåííûé ñåãìåíò. Ðàññòîÿíèå ìåæäó VL1 ðàâíî 2.1 - 3.6 òïí. Ëîêóñ ñåìåéñòâà L3 èìååò îêîëî 30 VL3 ñåãìåíòîâ, ðàñïîëàãàþùèõñÿ ãðóïïàìè, JL3 è CL3 ñåãìåíòû ðàñïîëàãàþòñÿ ïàðàìè: JCL31 è JCL32 (Stewart et al., 1993; Haire et al., 1996).

Òðåòèé òèï ãåíîâ L-öåïåé ëÿãóøêè áîëåå áëèçîê ê ëÿìáäà òèïó ìëåêîïèòàþùèõ: à) áîëåå âûñîêàÿ ãîìîëîãèÿ ñ ãåíàìè ëÿìáäà òèïà ìëåêîïèòàþùèõ (îêîëî 50% ñ l- è 30-40% ñ k-òèïîì ïî àìèíîêèñëîòíîé ïîñëåäîâàòåëüíîñòè); á) JL3 è CL3 ãåííûå ñåìåíòû ýêñïðåññèðóþòñÿ âñåãäà ïàðàìè JL31-CL31 è JL32-CL32, ÷òî íàïîìèíàåò ñèòóàöèþ â ëÿìáäà ëîêóñå ÷åëîâåêà è ìûøè (Haire et al., 1996).

Ãåíû âòîðîãî òèïà L-öåïåé ëÿãóøêè íåçíà÷èòåëüíîå è ïðèáëèçèòåëüíî îäèíàêîâîå ñõîäñòâî ñ ãåíàìè êàïïà è ëÿìáäà òèïîâ ìëåêîïèòàþùèõ (30-40% è 25-40% ïî íóêëåîòèäíîé ïîñëåäîâàòåëüíîñòè, ñîîòâåòñòâåíî) (Schwager et al., 1991).

Ãåíåòè÷åñêîå ðàçíîîáðàçèå ó ëÿãóøêè äîñòàòî÷íî âåëèêî è ñðàâíèìî ñ ðàçíîîáðàçèåì ãåíîâ ó ìëåêîïèòàþùèõ. Îäíàêî ðåïåðòóàð àíòèòåëüíûõ ñïåöèôè÷íîñòåé â ñûâîðîòêå êðîâè çíà÷èòåëüíî óñòóïàåò ðåïåðòóàðó âûñøèõ ïîçâîíî÷íûõ (Hsu et al., 1991). Ýòîò ïàðàäîêñ ìîæíî îáúÿñíèòü íàëè÷èåì ìåõàíèçìà ñîìàòè÷åñêîé ñåëåêöèè êëîíîâ Â-ëèìôîöèòîâ, êîòîðûé ýëèìèíèðóåò êëåòêè, íåñóùèå àíòèòåëà, ñïåöèôè÷íûå ê ñîáñòâåííûì àíòèãåíàì îðãàíèçìà, à òàêæå òå êëåòêè, êîòîðûå ïðîäóöèðóþò íåñêîëüêî òèïîâ àíòèòåë (Wilson et al., 1992).

Îñíîâíîé âêëàä â ôîðìèðîâàíèå ðàçíîîáðàçèÿ L-öåïåé àíòèòåë ó ëÿãóøêè äàþò ïåðâîå è òðåòüå ñåìåéñòâà ãåíîâ, èìåþùèå âûñîêèé êîìáèíàòèâíûé ïîòåíöèàë è áîëüøîå ðàçíîîáðàçèå çàðîäûøåâûõ V ãåííûõ (Haire et al., 1996). Âòîðîå ñåìåéñòâî èìååò íåñêîëüêî ñëàáî îòëè÷àþùèõñÿ äðóã îò äðóãà VL2 ýëåìåíòîâ è íå èãðàåò ñóùåñòâåííîé ðîëè â ôîðìèðîâàíèè ðàçíîîáðàçèÿ (Stewart et al., 1993). Òàêèì îáðàçîì, ðàçíîîáðàçèå ãåíîâ L-öåïåé ó ëÿãóøêè à ñîçäàåòñÿ ïîñðåäñòâîì: à) êîìáèíàòèâíîãî ñîåäèíåíèÿ V è J ãåííûõ ñåãìåíòîâ; á) ñìåùåíèÿ ðåêîìáèíàöèîííîé ðàìêè ïðè ñîåäèíåíèè V è J ñåãìåíòîâ. Íåëüçÿ èñêëþ÷èòü, ÷òî îïðåäåëåííûé âêëàä â ðàçíîîáðàçèå ìîæåò âíîñèòü ñîìàòè÷åñêèé ìóòàãåíåç. Âî âñÿêîì ñëó÷àå, íàëè÷èå ýòîãî ìåõàíèçìà ïîêàçàíî äëÿ ãåíîâ H-öåïåé ëÿãóøêè (Zezza et al., 1992).

ÝÂÎËÞÖÈß ÃÅÍÎÂ L-ÖÅÏÅÉ ÈÃ

Ñîãëàñíî íàèáîëåå ïîïóëÿðíîé â íàñòîÿùèé ìîìåíò ãèïîòåçå ãåíû Èà è Ò-êëåòî÷íûõ ðåöåïòîðîâ ïðîèçîøëè îò îäíîãî ïðåäêîâîãî ãåíà, êîäèðîâàâøåãî îäèí äîìåí ïóòåì ðàçëè÷íûõ âàðèàíòîâ ïîñëåäîâàòåëüíûõ äóïëèêàöèé (ðèñ. 7).

 ýâîëþöèè ãåíîâ Èà ìîæíî âûäåëèòü òðè îñíîâíûõ ñîáûòèÿ.

1. Ðàçäåëåíèå ïðåäêîâîãî V-ïîäîáíîãî ãåíà íà V è J ñåãìåíòû è âîçíèêíîâåíèå ìåõàíèçìà ãåíåðàöèè ðàçíîîáðàçèÿ ïóòåì ñîìàòè÷åñêîé ðåêîìáèíàöèè. Ïðåäïîëîãàåòñÿ, ÷òî ýòî ñîáûòèå ñâÿçàíî ñ âíåäðåíèåì òðàíñïîçîíà â ïðåäêîâûé ãåí è îñóùåñòâèëîñü äî ðàçäåëåíèÿ Èà è Ò-êëåòî÷íûõ ðåöåïòîðîâ ó ïðåäêîâ õðÿùåâûõ ðûá (Gilbert, 1990). Íàëè÷èå â ãåíîìå àêóë è ñêàòîâ ñëèòûõ VJ ãåíîâ â ëîêóñàõ L-öåïåé êëàññîâ I è II, ÿâëÿåòñÿ, ïî-âèäèìîìó, âòîðè÷íûì ñîáûòèåì è, âîçìîæíî, îáóñëîâëåíî ôèêñàöèåé ãåíîâ, êîäèðóþùèõ àíòèòåëà ñòðîãî îïðåäåëåííîé ñïåöèôè÷íîñòè (Anderson et al., 1995).

2. Âîçíèêíîâåíèå ìåõàíèçìîâ ñîìàòè÷åñêîãî ìóòàãåíåçà ãåíîâ ÈÃ. Ó ìëåêîïèòàþùèõ ñîìàòè÷åñêèé ìóòàãåíåç îáåñïå÷èâàåò êàê ìèíèìóì ïîëîâèíó ðàçíîîáðàçèÿ àíòèòåë, ÿâëÿÿñü îñíîâîé àôôèííîãî ñîçðåâàíèÿ àíòèòåë ïðè âòîðè÷íîì èììóííîì îòâåòå (Ïîë, 1987). Äîñòàòî÷íî âûðàæåí ñîìàòè÷åñêèé ìóòàãåíåç òàêæå ó ïòèö (Thompson and Neiman, 1987; Reynaund et al., 1987).

Ðÿä äàííûõ ïîçâîëÿåò ïðåäïîëàãàòü, ÷òî ñîìàòè÷åñêèé ìóòàãåíåç ìîæåò îñóùåñòâëÿòüñÿ ó õðÿùåâûõ ðûá è ó àìôèáèé, íî ýòè ðåçóëüòàòû íóæäàþòñÿ â áîëåå òùàòåëüíîì èçó÷åíèè.  ÷àñòíîñòè, ó õðÿùåâûõ ðûá ïîëó÷åíèå äîñòîâåðíûõ ñâèäåòåëüñòâ çàòðóäíåíî íàëè÷èåì ìíîæåñòâåíûõ êëàñòåðîâ ãåíîâ, ÷òî íå ïîçâîëÿåò íàäåæíî ñîîòíîñèòü äàííûå ïî ãåíîìíîé ñòðóêòóðå è ñòðóêòóðå êÄÍÊ (Litman et al., 1993).

3. Ïåðåõîä îò êëàñòåðíîé ê ñåãìåíòàðíîé îðãàíèçàöèè ãåííûõ ñåãìåíòîâ. Ñåãìåíòàðíàÿ îðãàíèçàöèÿ ìîæåò èìåòü íåñêîëüêî ïðåèìóùåñòâ. Âî-ïåðâûõ, óâåëè÷èâàåòñÿ ðàçíîîáðàçèå ïðîäóöèðóåìûõ àíòèòåë çà ñ÷åò äîïîëíèòåëüíûõ âîçìîæíîñòåé êîìáèíèðîâàíèÿ ðàçíûõ V è J ñåãìåíòîâ. Âî-âòîðûõ, óìåíüøàåòñÿ ðàçìåð ëîêóñà çà ñ÷åò

Ðèñ. 7. Ãèïîòåòè÷åñêàÿ ñõåìà ýâîëþöèè ñòðóêòóðíîé îðãàíèçàöèè ëîêóñîâ ãåíîâ L-öåïåé Èà ïîçâîíî÷íûõ. (Anderson et al., 1995; Gilbert, 1990).

Îáîçíà÷åíèÿ: - ñèãíàëüíûå îëèãîìåðû, ôëàíêèðóþùèå V è J ñåãìåíòû.

ðåçêîãî ñîêðàùåíèÿ êîëè÷åñòâà C ãåíîâ. Â-òðåòüèõ, ïîäîáíàÿ îðãàíèçàöèÿ ïîçâîëÿåò óïðîñòèòü ðåãóëÿöèþ ýêñïðåññèè ðàçëè÷íûõ ëîêóñîâ.

Êëþ÷åâûì ïðèíöèïîì ôóíêöèîíèðîâàíèÿ èììóííîé ñèñòåìû ÿâëÿåòñÿ ïðèíöèï êëîíàëüíîé ñåëåêöèè èììóíîêîìïåòåíòíûõ êëåòîê, íåñóùèõ ðåöåïòîð îïðåäåëåííîé ñïåöèôè÷íîñòè. Ðÿä êîñâåííûõ äàííûõ ïîçâîëÿåò ñ÷èòàòü, ÷òî ó àêóë ãóìîðàëüíûé èììóííûé îòâåò êëîíàëüíî îãðàíè÷åí (Shankey and Clem, 1980). Îäíàêî íåèçâåñòíî, êàêèì îáðàçîì è íàñêîëüêî ýôôåêòèâíî îñóùåñòâëÿåòñÿ ýòî îãðàíè÷åíèå (Flajnik, 1996). Ó ìëåêîïèòàþùèõ ïðèíöèï “îäíà êëåòêà - îäíî àíòèòåëî” îáåñïå÷èâàåòñÿ áëàãîäàðÿ èçîòèïè÷åñêîìó è àëëåëüíîìó èñêëþ÷åíèþ. Ïðè ñåãìåíòàðíîé îðãàíèçàöèè ãåíîâ ïðîäóêòèâíàÿ ïåðåñòðîéêà â îäíîì èç ëîêóñîâ âåäåò ê áëîêèðîâàíèþ ïåðåñòðîéêè äðóãèõ ëîêóñîâ è, òåì ñàìûì ê èõ èíàêòèâàöèè. Îäíàêî, â ñëó÷àå íàëè÷èÿ ìíîæåñòâåííûõ VJC êëàñòåðîâ, â ÷àñòè èç êîòîðûõ VJ ñåãìåíòû ñëèòû â çàðîäûøåâîé ÄÍÊ, ìåõàíèçìû êîíòðîëÿ âûáîðî÷íîé ýêñïðåññèè ìîãóò áûòü áîëåå ñëîæíûìè èëè íå ñòîëü ýôôåêòèâíûìè. Òàêèì îáðàçîì, ïåðåõîä îò êëàñòåðíîé ê ñåãìåíòàðíîé ôîðìå îðãàíèçàöèè ãåíîâ Èà ìîã èìåòü ïðèíöèïèàëüíîå çíà÷åíèå äëÿ ôîðìèðîâàíèÿ ïîëíîöåííîé ñèñòåìû ãóìîðàëüíîãî èììóíèòåòà.

Âîïðîñ î òîì, íà êàêîì ýòàïå ôèëîãåíåçà ïðîèçîøåë ýòîò ïåðåõîä îñòàåòñÿ îòêðûòûì. Óæå ó àìôèáèé ãåíû Èà L- è Í-öåïåé îðãàíèçîâàíû ñåãìåíòàðíî. Ïðè ýòîì, â ñëó÷àå L-öåïåé íàáëþäàåòñÿ äâà îñíîâíûõ òèïà îðãàíèçàöèè: êàïïà-ïîäîáíûé (îäèí Ñ ãåí, ñåìåéñòâî J ñåãìåíòîâ è ñåìåéñòâî V ñåãìåíòîâ) è ëÿìáäà ïîäîáíûé (íåñêîëüêî ïàð JC è ñåìåéñòâî V ñåãìåíòîâ). Ïî âñåé âèäèìîñòè, ðàçëè÷íûå òèïû L-öåïåé àìôèáèé ïðîèçîøëè îò ðàçëè÷íûõ òèïîâ L-öåïåé õðÿùåâûõ ðûá, îäíàêî îòíîñèòåëüíî íåâûñîêàÿ ãîìîëîãèÿ ïî ïåðâè÷íîé ñòðóêòóðå íå ïîçâîëÿåò óòâåðæäàòü ýòîãî ñ îïðåäåëåííîñòüþ (Gilbert, 1990).

Ó ñîìèêà è ðàäóæíîé ôîðåëè, ïðåäñòàâèòåëåé êîñòèñòûõ ðûá, îðãàíèçàöèÿ ãåíîâ L-öåïåé è Í-öåïåé îòëè÷àåòñÿ. Ãåíû Í-öåïåé êîñòèñòûõ ðûá îðãàíèçîâàíû ïîäîáíî ìëåêîïèòàþùèì ñåãìåíòàðíî (Bengten et al., 1991). Îðãàíèçàöèÿ ãåíîâ L-öåïåé èìååò êëàñòåðíûé õàðàêòåð.  òî æå âðåìÿ, â îòëè÷èå îò õðÿùåâûõ ðûá, òðàíñêðèïöèîííàÿ îðèåíòàöèÿ V ãåíîâ ó íèõ èçìåíåíà.

Ñëåäóåò îòìåòèòü, ÷òî ñîìîâûå è ëîñîñåâûå ÿâëÿþòñÿ äîâîëüíî ñïåöèàëèçèðîâàííîé ãðóïïîé, âîçíèêøåé â ýâîëþöèè îòíîñèòåëüíî íåäàâíî (Ðèñ. 8). Îñîáåííîñòè îðãàíèçàöèè ãåíîâ ëåãêèõ öåïåé ó ýòèõ òàêñîíîâ ìîãóò ïðåäñòàâëÿòü ñîáîé íîâîïðèîáðåòåííûå ïðèçíàêè (Romer, 1966).

 ñâÿçè ñ ýòèì îñîáûé èíòåðåñ ïðåäñòàâëÿåò èçó÷åíèå ñòðóêòðû è îðãàíèçàöèè ãåíîâ L-öåïåé Èà ó êîñòíî-õðÿùåâûõ ðûá. Êîñòíî-õðÿùåâûå ÿâëÿþòñÿ àðõàè÷íîé ãðóïïîé êîñòèñòûõ ðûá, âîçíèêøåé çíà÷èòåëüíî ðàíüøå íàñòîÿùèõ êîñòèñòûõ. Íåñìîòðÿ íà òî, ÷òî ñóùåñòâóþò ðàçëè÷íûå ìíåíèÿ îòíîñèòåëüíî ïîñëåäîâàòåëüíîñòè ïîÿâëåíèÿ êîñòíî-õðÿùåâûõ è äâîÿêîäûøàùèõ (ïðåäêîâ íàçåìíûõ ïîçâîíî÷íûõ) (Ðîìåð è Ïàðñîíñ, 1992; Þäêèí È. È., 1941), î÷åâèäíî, ÷òî êîñòíî-õðÿùåâûå â áîëüøåé ñòåïåíè ÷åì êîñòèòñòûå ñîõðàíèëè ÷åðòû äðåâíèõ ïåðâè÷íî-êîñòíûõ ðûá è, ñîîòâåòñòâåííî, ñ áîëüøèì îñíîâàíèåì ìîãóò ðàññìàòðèâàòüñÿ êàê ïðîìåæóòî÷íîå çâåíî ìåæäó õðÿùåâûìè ðûáàìè è àìôèáèÿìè.

Ðèñ. 8. Ýâîëþöèîííîå äðåâî íèçøèõ ïîçâîíî÷íûõ ( ïî Ñåâåðöåâó À. Í., 1939).

Îáîçíà÷åíèÿ: - òàêñîíû, èìåþùèå íûíå æèâóùèõ ïðåäñòàâèòåëåé, - òàêñîíû, ñóùåñòâîâàíèå êîòîðûõ äîêàçàíî ïàëåîíòîëîãè÷åñêèìè èññëåäîâàíèÿìè.

ÌÀÒÅÐÈÀËÛ È ÌÅÒÎÄÛ

ÝËÅÊÒÐÎÔÎÐÅÇ ÄÍÊ

 àãàðîçíîì ãåëå.

Ýëåêòðîôîðåç ÄÍÊ ïðîâîäèëè â 1% àãàðîçíîì ãåëå â 1-êðàòíîì áóôåðå ÒÀÅ, èìåþùåì ñîñòàâ: 0.04 Ì òðèñ-àöåòàò, 2 ìÌ Na2ÝÄÒÀ (Ìàíèàòèñ è äð., 1984).

 ïîëèàêðèëàìèäíîì ãåëå.

Ýëåêòðîôîðåç ÄÍÊ ïðîâîäèëè â 6% ïîëèàêðèëàìèäíîì ãåëå â 0,5-êðàòíîì áóôåðå ÒÁÅ, èìåþùåì ñîñòàâ: 0,089 Ì òðèñ-áîðàò, 0,089 Ì áîðíàÿ êèñëîòà, 2 ìÌ Na2ÝÄÒÀ. Äëÿ ïîëèìåðèçàöèè ãåëÿ ê 50 ìë ðàñòâîðà äîáàâëÿëè 300 ìêë 10% ðàñòâîðà ïåðñóëüôàòà àììîíèÿ è 30 ìêë ÒÅÌÅÄ (Ìàíèàòèñ è äð., 1984).

ÂÛÄÅËÅÍÈÅ ÄÍÊ ÈÇ ÃÅËß

Àäñîðáöèÿ íà äèýòèëàìèíîýòèëöåëëþëîçå.

Ãåëü îêðàøèâàëè â ðàñòâîðå áðîìèñòîãî ýòèäèÿ, ó÷àñòîê ãåëÿ ñ ïîëîñîé ÄÍÊ âûðåçàëè, ïîìåùàëè â êàìåðó è ïåðåíîñèëè ÄÍÊ íà äèýòèëàìèíîýòèëöåëëþëîçó â 0,5-êðàòíîì áóôåðå ÒÁÅ (ñì. Ýëåêòðîôîðåç ÄÍÊ (2)) ïðè íàïðÿæåíèè 40 Â/ñì. Ýëþöèþ ÄÍÊ ñ äèýòèëàìèíîýòèëöåëëþëîçû ïðîâîäèëè ïóòåì èíêóáèðîâàíèÿ â òå÷åíèå 30 ìèí ïðè 70îÑ â áóôåðå, èìåþùåì ñîñòàâ: 2 ìÌ NaCl, 1 ìÌ Na2ÝÄÒÀ, 40 ìÌ òðèñ ðÍ 8,0 (Ìàíèàòèñ è äð., 1984).

Àäñîðáöèÿ íà êðåìíèåâîé ïóäðå.

Àãàðîçíûé ãåëü îêðàøèâàëè â ðàñòâîðå áðîìèñòîãî çòèäèÿ, âûðåçàëè ó÷àñòîê ãåëÿ ñ ÄÍÊ è ðàñïëàâëÿëè èíêóáèðîâàíèåì ñ äâîéíûì îáúåìîì 6 Ì ðàñòâîðà KI â òå÷åíèå 10 ìèí ïðè 55îÑ. Çàòåì äîáàâëÿëè ñóñïåíçèþ êðåìíèåâîé ïóäðû (ñèëèêè) â 3 Ì ðàñòâîðå KI â êîíöåíòðàöèè 100 ìã/ìë èç ðàñ÷åòà 300 ìêã ñèëèêè íà 1 ìêã ÄÍÊ è èíêóáèðîâàëè â òå÷åíèå 2 ìèí ïðè 55îÑ. Ïîñëå ýòîãî îñàæäàëè ñèëèêó öåíòðèôóãèðîâàíèåì ïðè 2000 g â òå÷åíèå 2 ìèí è äâàæäû ïðîìûâàëè ñóñïåíäèðîâàíèåì â ðàñòâîðå, ñîäåðæàùåì 50 ìÌ NaCl, 10 ìÌ òðèñ-HCl, ðÍ 8,0, 2,5 ìÌ Na2ÝÄÒÀ è 50% ýòèëîâûé ñïèðò. Ýëþèðîâàëè ÄÍÊ ñ ñèëèêè ñóñïåíäèðîâàíèåì â âîäå (Boyle, Lew, 1995).

Çàìîðàæèâàíèå - îòòàèâàíèå.

Àãàðîçíûé ãåëü ñ ÄÍÊ 10 ìèí èíêóáèðîâàëè â æèäêîì àçîòå è îñàæäàëè öåíòðèôóãèðîâàíèåì ïðè 12000 g â òå÷åíèå 15 ìèí, ïîñëå ÷åãî äîáàâëÿëè ê ñóïåðíàòàíòó 1/10 îáúåìà 3 Ì NaAc, 2 îáúåìà ýòàíîëà è îñàæäàëè ÄÍÊ ïðè 12000 g â òå÷åíèå 10 ìèí.

ÏÎËÓ×ÅÍÈÅ ÐÀÄÈÎÀÊÒÈÂÍÛÕ ÇÎÍÄÎÂ

500 íã ÄÍÊ-ìàòðèöû è 100 íã ïðàéìåðà äåíàòóðèðîâàëè â 10 ìêë âîäû ïðè 100îÑ â òå÷åíèå 10 ìèí è áûñòðî îõëàæäàëè äî 0îÑ. Çàòåì äîáàâëÿëè 10 ìêë 10-êðàòíîãî áóôåðà (40 ìÌ KP04 ðÍ 7,5, 6,6 ìÌ MgCl2 è 1,0 ìÌ 2-ìåðêàïòîýòàíîë), 0,1-0,5 ìÊè 32Ð-dATÔ, 10 ìêë 2 ìÌ ðàñòâîðà òðåõ äðóãèõ íåìå÷åíûõ äÍTÔ äî êîíöåíòðàöèè 200 ìêÌ. Îáúåì ðåàêöèîííîé ñìåñè äîâîäèëè âîäîé äî 100 ìêë, äîáàâëÿëè 3 ìêë ôðàãìåíòà Êëåíîâà ÄÍÊ-ïîëèìåðàçû I (10-12 å.à.) è èíêóáèðîâàëè ïðè êîìíàòíîé òåìïåðàòóðå â òå÷åíèå 30 ìèí. Î÷èñòêó çîíäà ïðîâîäèëè ìåòîäîì ãåëü - ôèëüòðàöèè íà êîëîíêå ñ áèîãåëåì Ï-10 (Ìàíèàòèñ è äð., 1984).

ÂÛÄÅËÅÍÈÅ ÏËÀÇÌÈÄÍÎÉ ÄÍÊ

Êëåòêè Escherichia coli, âûðàùåííûå â ñðåäå Ëóðèà-Áåðòàíè (1% NaCl, 1% áàêòî-òðèïòîí, 0,5% áàêòî-äðîææåâîé ýêñòðàêò, ðÍ 7,5) (ñðåäà LB) ñ àìïèöèëëèíîì (50 ìêã/ìë), îñàæäàëè öåíòðèôóãèðîâàíèåì ïðè 4000 g. Çàòåì îñàäîê ñóñïåíäèðîâàëè â áóôåðå STET (8% ñàõàðîçà, 0,5% òðèòîí X-100, 10 ìÌ òðèñ-HCl è 50 ìÌ Na2ÝÄÒÀ, ðÍ 8,0) è äîáàâëÿëè ëèçîöèì äî êîíöåíòðàöèè 0,8 ã/ìë. Ñìåñü èíêóáèðîâàëè ïðè êîìíàòíîé òåìïåðàòóðå â òå÷åíèå 5 ìèí è ïðè 100îÑ â òå÷åíèå 1 ìèí. Ïîñëå ýòîãî êëåòî÷íûé äåáðèñ îñàæäàëè öåíòðèôóãèðîâàíèåì ïðè 16000 g â òå÷åíèå 15 ìèí.

Äëÿ îñàæäåíèÿ ïëàçìèäíîé ÄÍÊ ê ñóïåðíàòàíòó äîáàâëÿëè 1/10 îáúåìà 3 Ì ðàñòâîðà àöåòàòà íàòðèÿ, ðàâíûé îáúåì èçîïðîïàíîëà è öåíòðèôóãèðîâàëè ïðè 16000 g â òå÷åíèå 15 ìèí ïðè 20îÑ. Çàòåì ïðîìûâàëè îñàäîê äîáàâëåíèåì 80% ýòàíîëà è ïîâòîðíûì öåíòðèôóãèðîâàíèåì â òå÷åíèå 5 ìèí ïðè 20îÑ (Ìàíèàòèñ è äð., 1984).

Î×ÈÑÒÊÀ ÏËÀÇÌÈÄÍÎÉ ÄÍÊ ÌÅÒÎÄÎÌ ÐÀÂÍÎÂÅÑÍÎÃÎ ÖÅÍÒÐÈÔÓÃÈÐÎÂÀÍÈß Â ÃÐÀÄÈÅÍÒÅ ÏËÎÒÍÎÑÒÈ CsCl

Íà êàæäûå 10 ìë ðàñòâîðà ïëàçìèäíîé ÄÍÊ, ïîëó÷åííîãî ïîñëå îñàæäåíèÿ ëèçèðîâàííûõ êëåòîê (ñì. Âûäåëåíèå ïëàçìèäíîé ÄÍÊ), äîáàâëÿëè 1 ã ñóõîãî CsCl, ñîëü ðàñòâîðÿëè, ïîñëå ÷åãî íà êàæäûå 10 ìë ðàñòâîðà äîáàâëÿëè 0,8 ìë ðàñòâîðà áðîìèñòîãî ýòèäèÿ ñ êîíöåíòðàöèåé 10 ìã/ìë. Ñìåñü ïîìåùàëè â öåíòðèôóæíûå ïðîáèðêè Beckman, çàïîëíÿëè äîâåðõó ðàñòâîðîì CsCl è áðîìèñòîãî ýòèäèÿ òîé æå ïëîòíîñòè è öåíòðèôóãèðîâàëè â ðîòîðå Ti 60 ïðè 45000 îá/ìèí è òåìïåðàòóðå 20îÑ â òå÷åíèå 36 ÷àñîâ. Ïîñëå ýòîãî îòáèðàëè êîëüöåâóþ êîâàëåíòíî çàìêíóòóþ ïëàçìèäíóþ ÄÍÊ è ýêñòðàãèðîâàëè áðîìèñòûé ýòèäèé èç ðàñòâîðà äî ïîëíîãî îáåñöâå÷èâàíèÿ ðàâíûì îáúåìîì í-áóòàíîëà, ïðåäâàðèòåëüíî íàñûùåííîãî 1 Ì ðàñòâîðîì NaCl.

ÄÍÊ îñàæäàëè öåíòðèôóãèðîâàíèåì ïðè 15000 g, äîáàâèâ ðàâíûé îáúåì 1 Ì ðàñòâîðà NH4Cl è äâà îáúåìà ýòàíîëà. Ïîñëå ïðîìûâàíèÿ ýòàíîëîì îñàäîê ÄÍÊ ðàñòâîðÿëè â âîäå äî êîíöåíòðàöèè 1 ìêã/ìêë (Ìàíèàòèñ è äð., 1984).

ÒÐÀÍÑÔÎÐÌÀÖÈß ÏÐÎÊÀÐÈÎÒÈ×ÅÑÊÈÕ ÊËÅÒÎÊ

Õèìè÷åñêàÿ òðàíñôîðìàöèÿ.

Äëÿ ïîäãîòîâêè êîìïåòåíòíûõ êëåòîê E.coli øòàìì XL-1 Blue MRF ' è âûðàùèâàëè â 100 ìë 2-êðàòíîé ñðåäû Ëóðèà (2% áàêòî-òðèïòîí, 1% áàêòî-äðîææåâîé ýêñòðàêò, 0,1% NaCl, 0,4% ãëþêîçà, ðÍ 7,0) ïðè 37îÑ äî îïòè÷åñêîé ïëîòíîñòè D550=0,35. Êëåòî÷íóþ ñóñïåíçèþ âûäåðæèâàëè ïðè 0îÑ â òå÷åíèå 2 ÷àñîâ. Çàòåì êëåòêè îñàæäàëè öåíòðèôóãèðîâàíèåì ïðè 4000 g, òåìïåðàòóðå 4îÑ è ñóñïåíäèðîâàëè â 50 ìë ëåäÿíîãî áóôåðà À (100 ìÌ CaCl2, 70 ìÌ MnCl2, 40 ìÌ NaAc, ðÍ 5,5). Ïîñëå ýòîãî ñóñïåíçèþ êëåòîê âûäåðæèâàëè ïðè 0îÑ â òå÷åíèå 30 ìèí, ïîñëå ÷åãî êëåòêè îñàæäàëè è ñóñïåíäèðîâàëè â 5 ìë áóôåðà À ñ 15% ãëèöåðèíà.

Äëÿ òðàíñôîðìàöèè ê 200 ìêë ñóñïåíçèè êîìïåòåíòíûõ êëåòîê äîáàâëÿëè 30 íã ïëàçìèäíîé ÄÍÊ, ðàñòâîðåííîé â 100 ìêë âîäû è âûäåðæèâàëè ïðè 0îÑ â òå÷åíèå 30 ìèí. Çàòåì èíêóáèðîâàëè ïðè 37îÑ â òå÷åíèå 5 ìèí, ïîñëå ÷åãî äîáàâëÿëè 3 ìë ñðåäû LB è èíêóáèðîâàëè ïðè 37îÑ åùå 90 ìèí. Êëåòêè ñîáèðàëè öåíòðèôóãèðîâàíèåì è âûñåâàëè íà ñåëåêòèâíóþ ñðåäó (Ìàçèí è äð., 1988).

Ýëåêòðîòðàíñôîðìàöèÿ.

Äëÿ ïîäãîòîâêè êîìïåòåíòíûõ êëåòîê E.coli øòàìì XL-1 Blue MRF ' âûðàùèâàëè â 100 ìë ñðåäû LB (ñì. Õèìè÷åñêàÿ òðàíñôîðìàöèÿ) ïðè êîìíàòíîé òåìïåðàòóðå äî îïòè÷åñêîé ïëîòíîñòè D550=0,45. Çàòåì êëåòêè îñàæäàëè öåíòðèôóãèðîâàíèåì ïðè 4000 g, 4îÑ è ïðîìûâàëè ñóñïåíäèðîâàíèåì ïîñëåäîâàòåëüíî â 100 ìë, 50 ìë è 10ìë 10% ðàñòâîðà ãëèöåðèíà ïðè 0-4îÑ. Ïîñëå ýòîãî êëåòêè ñóñïåíäèðîâàëè â 240 ìêë ëåäÿíîãî ðàñòâîðà GYT (10% ãëèöåðèí, 0,125% áàêòî-äðîææåâîé ýêñòðàêò, 0,25% áàêòî-òðèïòîí).

Äëÿ òðàíñôîðìàöèè ê 40 ìêë ñóñïåíçèè êîìïåòåíòíûõ êëåòîê äîáàâëÿëè 1 ìêë ÄÍÊ âåêòîðà (50 íã) ïðè 0-4îÑ è ïðîïóñêàëè ýëåêòðè÷åñêèé ðàçðÿä (U=18000 Â). Çàòåì äîáàâëÿëè 1 ìë SOC (2% áàêòî-òðèïòîí, 0,5% áàêòî-äðîææåâîé ýêñòðàêò, 10 ìÌ NaCl, 2,5 ìÌ KCl, 10 ìÌ MgCl2, 10 ìÌ MgSO4, 20 ìÌ ãëþêîçà), ïåðåìåøèâàëè, ïåðåíîñèëè â 3 ìë ñðåäû SOC, ïðîãðåòîé äî 42îÑ, è èíêóáèðîâàëè ïðè 37îÑ â òå÷åíèå 1 ÷àñà (Wai Lin Tung and King-C. Chow, 1995).

ÂÛÄÅËÅÍÈÅ ËÅÉÊÎÖÈÒÎÂ ÈÇ ÊÐÎÂÈ ÐÛÁ

Êðîâü ñîáèðàëè íà õîëîäó ÷åðåç êàóäàëüíóþ àðòåðèþ ñ äîáàâëåíèåì íà êàæäûå 5 ìë êðîâè 1 ìë 2,7% ðàñòâîðà Na2ÝÄÒÀ, ðÍ 7,4. Ê âûäåëåííîé êðîâè äîáàâëÿëè ðàâíûé îáúåì òðèñ-ñîëåâîãî áóôåðà (TBS) (0,14 Ì NaCl, 5 ìÌ KCl, 25 ìÌ òðèñ-HCl, ðÍ 7,4). Ñìåñü íàíîñèëè ïðè êîìíàòíîé òåìïåðàòóðå íà ðàâíûé îáúåì ñðåäû äëÿ âûäåëåíèÿ ëåéêîöèòîâ, ñîäåðæàùåé 24 ÷àñòè 9% ôèêîëà è 10 ÷àñòåé 34% âåðîãðàôèíà. Ïîñëå öåíòðèôóãèðîâàíèÿ ïðè 400 g â òå÷åíèå 30 ìèí îòáèðàëè ñëîé ëåéêîöèòîâ è ðàçâîäèëè â áîëüøîì îáúåìå áóôåðà TBS. Ïîñëå ïîâòîðíîãî öåíòðèôóãèðîâàíèÿ ïðè 300 g â òå÷åíèå 40 ìèí äëÿ ëèçèñà îñòàòî÷íûõ ýðèòðîöèòîâ êëåòêè ñóñïåíäèðîâàëè â ðàñòâîðå, ñîäåðæàùåì 9 îáúåìîâ 0,83% ðàñòâîðà NH4Cl è 1 îáúåì 2,06% ðàñòâîðà òðèñ-HCl, ðÍ 7,62, äî êîíöåíòðàöèè 108 êë/ìë è äîáàâëÿëè 5 îáúåìîâ ñðåäû. Ïîñëå îñàæäåíèÿ êëåòîê ïðè 300 g â òå÷åíèå 10 ìèí ïðîöåäóðó î÷èñòêè ïîâòîðèëè (Ôðèìåëü, 1987).

ÂÛÄÅËÅÍÈÅ ÑÓÌÌÀÐÍÎÉ ÐÍÊ ÈÇ ËÅÉÊÎÖÈÒÎÂ

Îñàäîê ëåéêîöèòîâ ïîñëå âûäåëåíèÿ è î÷èñòêè ñóñïåíäèðîâàëè â 10 îáúåìàõ (1 ìë) ðàñòâîðà 1, ñîäåðæàùåãî 4 Ì ãóàíèäèí òèîöèàíàò, 25 ìÌ öèòðàò íàòðèÿ, ðÍ 7,0, 0,5% ñàðêîçèë è 0,1 Ì 2-ìåðêàïòîýòàíîë, ïðè êîìíàòíîé òåìïåðàòóðå. Çàòåì äîáàâëÿëè 0,1 ìë 2 Ì ðàñòâîðà NaAc, ðÍ 4,0, 1 ìë ôåíîëà, 0,2 ìë õëîðîôîðìà è ïåðåìåøèâàëè. Çàòåì öåíòðèôóãèðîâàëè ïðè 10000 g â òå÷åíèå 20 ìèí ïðè 4îÑ, îòáèðàëè âîäíóþ ôàçó, äîáàâëÿëè ê íåé ðàâíûé îáúåì èçîïðîïàíîëà è îñàæäàëè ÐÍÊ öåíòðèôóãèðîâàíèåì ïðè 15000 g â òå÷åíèå 15 ìèí ïðè 4îÑ (Chomczynski and Sacchi, 1987).

ÂÛÄÅËÅÍÈÅ ÂÛÑÎÊÎÌÎËÅÊÓËßÐÍÎÉ ÄÍÊ ÈÇ ÝÓÊÀÐÈÎÒÈ×ÅÑÊÈÕ ÊËÅÒÎÊ

1 ã ïå÷åíè ñòåðëÿäè, çàìîðîæåííîé â æèäêîì àçîòå, ðàñòèðàëè â òîíêèé ïîðîøîê è ãîìîãåíèçèðîâàëè â 15 ìë ðàñòâîðà, ñîäåðæàùåãî 0,5 Ì Na2ÝÄÒÀ, ðÍ 8,0, 0,5% ñàðêîçèëà, 100 ìêã/ìë ïðîòåèíàçû Ê è íàãðåòîãî äî 65îÑ. Çàòåì èíêóáèðîâàëè ïðè 50îÑ òå÷åíèå 3 ÷àñîâ ïðè ëåãêîì ïîêà÷èâàíèè. Çàòåì, èçáåãàÿ ðåçêèõ âñòðÿõèâàíèé, ýêñòðàãèðîâàëè ÄÍÊ ðàâíûì îáúåìîì ôåíîëà òðè ðàçà, êàæäûé ðàç ðàçäåëÿÿ ôðàêöèè öåíòðèôóãèðîâàíèåì ïðè 4000 g è êîìíàòíîé òåìïåðàòóðå. Ôåíîë ïðåäâàðèòåëüíî î÷èùàëè ïåðåãîíêîé è íàñûùàëè áóôåðîì, ñîäåðæàùèì 1 Ì òðèñ-HCl, îäèí ðàç è äâà ðàçà áóôåðîì, ñîäåðæàùèì 0,1 Ì òðèñ-HCl è 0,1% 2-ìåðêàïòîýòàíîë. Äèàëèç ÄÍÊ ïðîâîäèëè ïðè 10îÑ â òå÷åíèå 12 ÷àñîâ ïðîòèâ 4 ë áóôåðà, èìåþùåãî ñîñòàâ:

50 ìÌ òðèñ-HCl, ðÍ 8,0,

10 ìÌ Na2ÝÄÒÀ,

10 ìÌ NaCl.

Çàòåì îáðàáàòûâàëè ïðîáó ÐÍÊàçîé, ñâîáîäíîé îò ÄÍÊàçû,ïðè 37îÑ â òå÷åíèå 1 ÷àñà â êîíöåíòðàöèè 100 ìêã/ìë. Ïîñëå ýòîãî ýêñòðàãèðîâàëè ÄÍÊ ðàâíûì îáúåìîì ñìåñè ôåíîë-õëîðîôîðì (1:1) äâà ðàçà è ïðîâîäèëè äèàëèç ïðè 10îÑ â òå÷åíèå 36 ÷àñîâ ïðîòèâ 10 ë áóôåðà TE (10 ìÌ òðèñ-HCl, 1 ìÌ Na2ÝÄÒÀ, ðÍ 7,5), ìåíÿÿ áóôåð ÷åðåç êàæäûå 12 ÷àñîâ (Ìàíèàòèñ è äð., 1984).

ÊÎÍÑÒÐÓÈÐÎÂÀÍÈÅ ÁÈÁËÈÎÒÅÊÈ êÄÍÊ

Âûäåëåíèå ïîëè(A)+ÐÍÊ.

Äëÿ èíãèáèðîâàíèÿ ÐÍÊàçû âñå ðàñòâîðû, íå ñîäåðæàùèå òðèñ, îáðàáàòûâàëè 0,1% äèýòèëïèðîêàðáîíàòîì 12 ÷àñîâ ïðè 37îÑ è àâòîêëàâèðîâàëè. Ïîñóäó ïðîêàëèâàëè ïðè 250îÑ â òå÷åíèå 4 ÷àñîâ. Ïîëè(A)+ÐÍÊ âûäåëÿëè èç ñóììàðíîé ÐÍÊ ëåéêîöèòîâ ñòåðëÿäè ìåòîäîì õðîìàòîãðàôèè íà îëèãî(dT)-öåëëþëîçå. Äëÿ ýòîãî ÐÍÊ ðàñòâîðÿëè â âîäå, ïðîãðåâàëè ïðè 65îÑ â òå÷åíèå 5 ìèí, äîáàâëÿëè ðàâíûé îáúåì 2-êðàòíîãî áóôåðà äëÿ íàíåñåíèÿ ÐÍÊ (40 ìÌ òðèñ-HCl, ðÍ 7,6, 1 Ì NaCl, 2 ìÌ Na2ÝÄÒÀ, 0,2% SDS) è òðèæäû ïðîïóñêàëè ÷åðåç êîëîíêó ñ îëèãî(dT)-öåëëþëîçîé. Çàòåì ïðîìûâàëè êîëîíêó 5-10 îáúåìàìè áóôåðà äëÿ íàíåñåíèÿ è 4 îáúåìàìè ýòîãî æå áóôåðà, ñîäåðæàùåãî 0,1 Ì NaCl. Ïîñëå ýòîãî ýëþèðîâàëè ïîëè(A)+ÐÍÊ â 2-3 îáúåìàõ âîäû, îáðàáîòàííîé äèýòèëïèðîêàðáîíàòîì, äîáàâëÿëè 2,2 îáúåìà ýòàíîëà è îñàæäàëè öåíòðèôóãèðîâàíèåì â òå÷åíèå 10 ìèí ïðè 12000 g ïðè 4îÑ (Ìàíèàòèñ è äð., 1984).

Ñèíòåç êÄÍÊ.

Ñèíòåç êÄÍÊ ïðîâîäèëè â ñîîòâåòñòâèè ñ ïðîòîêîëîì ôèðìû Stratagene. Ïî ìàòðèöå ïîëè(A)+ÐÍÊ ñèíòåçèðîâàëè ïåðâóþ öåïü êÄÍÊ (ðèñ. 9).

Ðåàêöèîííàÿ èìåëà ñîñòàâ:

5 ìêë 10-êðàòíîãî áóôåðà äëÿ ñèíòåçà ïåðâîé öåïè,

3 ìêë ñìåñè ìåòèë-dÍTÔ,

2 ìêë ðàñòâîðà ïðàéìåð-ëèíêåðà (1.4 ìêã/ìêë),

1 ìêë èíãèáèòîðà ÐÍÊàçíîé àêòèâíîñòè,

1.5 ìêë ôåðìåíòà îáðàòíàÿ òðàíñêðèïòàçà (50 å.à./ìêë),

âîäà äî ñóììàðíîãî îáúåìà 50 ìêë.

Ñìåñü èíêóáèðîâàëè ïðè 37îÑ â òå÷åíèå 1 ÷àñà. Çàòåì îõëàæäàëè äî 0îÑ è äîáëÿëè êîìïîíåíòû äëÿ ñèíòåçà âòîðîé öåïè êÄÍÊ:

20 ìêë áóôåðà äëÿ ñèíòåçà âòîðîé öåïè,

6 ìêë ñìåñè dÍTÔ,

88,9 ìêë ñòåðèëüíîé âîäû,

2 ìêë 32Ð-dÍTÔ (800 Êè/ìÌ),

2 ìêë ðàñòâîðà ÐÍÊàçûH (1.5 å.à./ìêë),

11.1 ìêë ÄÍÊ ïîëèìåðàçû I.

Ñìåñü èíêóáèðîâàëè ïðè 16îÑ â òå÷åíèå 2,5 ÷àñîâ, çàòåì îõëàæäàëè äî 0îÑ è äîáàâëÿëè êîìïîíåíòû äëÿ çàñòðîéêè “ëèïêèõ” êîíöîâ:

23 ìêë ñìåñè äÍTÔ,

2 ìêë Pfu ÄÍÊ ïîëèìåðàçû (2,5 å.à./ìêë).

Ñìåñü èíêóáèðîâàëè ïðè 72îÑ â òå÷åíèå 30 ìèí.

Çàòåì ïðîâîäèëè ýêñòðàêöèþ ðàâíûì îáúåìîì ñìåñè ôåíîë-õëîðîôîðì (1:1) è ðàâíûì îáúåìîì õëîðîôîðìà, ïîñëå ÷åãî îòáèðàëè âîäíóþ ôàçó, äîáàâëÿëè 20 ìêë 3Ì NaAc è 400 ìêë 96% ýòàíîëà è îñàæäàëè êÄÍÊ öåíòðèôóãèðîâàíèåì ïðè 12000 g â òå÷åíèå 12 ìèí.

Ñøèâêà ìîëåêóë êÄÍÊ ñ âåêòîðîì.

êÄÍÊ ðàñòâîðÿëè ñ EcoR I àäàïòîðàìè (ðèñ. 9) è èíêóáèðîâàëè ïðè 4îÑ â òå÷åíèå 30 ìèí. Çàòåì äîáàâëÿëè êîìïîíåíòû äëÿ ñøèâêè ìîëåêóë àäàïòîðîâ è ìîëåóë êÄÍÊ:

ïðàéìåð-ëèíêåð

5' CTCGAGTTTTTTTTTTTT 3'

3' AAAAAAAAAAAA 5'

ïîëè(A)+ÐÍÊ

Xho I ñàéò 1-ÿ öåïü EcoR I àäàïòîð

5' ð-TCGAGTTTTTTTTTTTT,,,,,,,,CTCGTGCCG-ð 3'

3' ð-CAAAAAAAAAAAA GAGCACGGCTTAA-ð 5'

2-ÿ öåïü

Xho I ñàéò êÄÍÊ EcoR I ñàéò

5' CTCGAGTTTTTTT,,,,,,,,,CTCGTGCCGAATTC 3’

3' GAGCTCAAAAAAA GAGCACGGCTTAAG 5’

ÄÍÊ âåêòîðà ÄÍÊ âåêòîðà

Ðèñ. 9. Ñõåìà ñèíòåçà êÄÍÊ ïî ìàòðèöå ïîëè(A)+ÐÍÊ è ñøèâêè ñ ïëàçìèäíûì âåêòîðîì

pBluescript KS(+) ïî ñàéòàì EcoR I è Xho I.

Îáîçíà÷åíèÿ:,,,,, - ìåòèëèðîâàííàÿ öåïü êÄÍÊ, -íåìåòèëèðîâàííàÿ öåïü êÄÍÊ.

1 ìêë 10-êðàòíîãî áóôåðà ëèãèðîâàíèÿ,

1 ìêë 10 ìÌ ðATÔ,

1 ìêë ôåðìåíòà ÄÍÊ ëèãàçû ôàãà Ò4 (4 å.à./ìêë).

Ñìåñü èíêóáèðîâàëè ïðè 4îÑ â òå÷åíèå 2-õ ñóòîê, ïîñëå ÷åãî èíàêòèâèðîâàëè ëèãàçó ïðîãðåâàíèåì ïðè 70îÑ â òå÷åíèå 30 ìèí, îõëàæäàëè äî êîìíàòíîé òåìïåðàòóðû è äîáàâëÿëè êîìïîíåíòû äëÿ ôîñôîðèëèðîâàíèÿ êîíöåâûõ íóêëåîòèäîâ:

1 ìêë 10-êðàòíîãî áóôåðà ëèãèðîâàíèÿ,

2 ìêë 10 ìÌ ðATÔ,

6 ìêë ñòåðèëüíîé âîäû,

1 ìêë ôåðìåíòà ïîëèíóêëåîòèäíîé êèíàçû ôàãà Ò4 (10 å.à./ìêë).

Ðåàêöèîííóþ ñìåñü èíêóáèðîâàëè ïðè 37îÑ â òå÷åíèå 30 ìèí. Çàòåì îõëàæäàëè äî êîìíàòíîé òåìïåðàòóðû è äîáàâëÿëè êîìïîíåíòû äëÿ îáðàçîâàíèÿ ëèïêèõ êîíöîâ ïî ñàéòó ðåñòðèêöèè ýíäîíóêëåàçû Xho I:

28 ìêë áóôåðà 4,

3 ìêë Xho I (40 å.à./ìêë).

Ñìåñü èíêóáèðîâàëè ïðè 37îÑ â òå÷åíèå 1,5 ÷àñà. Çàòåì äîáàâëÿëè 5 ìêë 10-êðàòíîãî áóôåðà STE (1 Ì NaCl, 200 ìÌ òðèñ-HCl, ðÍ 7,5, 100 ìÌ Na2ÝÄÒÀ) è ïðîïóñêàëè ÷åðåç êîëîíêó ñ ãåëåì ñåôàêðèë Ñ-500. Ôðàêöèè, ñîäåðæàùèå ìîëåêóëû ñ ðàçìåðîì áîëåå 500 ïí îáúåäèíÿëè è ýêñòðàãèðîâàëè ÄÍÊ ðàâíûì îáúåìîì ñìåñè ôåíîë-õëîðîôîðì (1:1) è ðàâíûì îáúåìîì õëîðîôîðìà. Çàòåì äîáàâëÿëè äâîéíîé îáúåì ýòàíîëà, îñàæäàëè êÄÍÊ öåíòðèôóãèðîâàíèåì, ïðîìûâàëè 80% ýòàíîëîì è ðàñòâîðÿëè â 10 ìêë âîäû. Äëÿ ëèãèðîâàíèÿ áðàëè 5 ìêë ðàñòâîðà êÄÍÊ (600 íã) è 2 ìêë ðàñòâîðà âåêòîðà pBluescript KS(+) (1 ìêã), èìåþùåãî "ëèïêèå" äåôîñôîðèëèðîâàííûå êîíöû ïî ñàéòàì ðåñòðèêöèè ýíäîíóêëåàçàìè EcoR I è Xho I (ðèñ. 9).

Çàòåì äîáàâëÿëè 1 ìêë 10-êðàòíîãî áóôåðà 3, 1 ìêë 10 ìÌ ðàñòâîðà ðATÔ è 1 ìêë ôåðìåíòà ëèãàçû ôàãà Ò4 (4 å.à./ìêë). Ñìåñü èíêóáèðîâàëè ïðè 4îÑ â òå÷åíèå 2-õ ñóòîê, ïîñëå ÷åãî ýêñòðàãèðîâàëè ðàâíûìè îáüåìàìè ôåíîë-õëîðîôîðìà è õëîðîôîðìà.

Àìïëèôèêàöèÿ áèáëèîòåêè.

Ýëåêòðîòðàíñôîðìàöèþ ïðîâîäèëè êàê îïèñàíî â ï. Òðàíñôîðìàöèÿ ïðîêàðèîòè÷åñêèõ êëåòîê, ïîñëå ÷åãî âûñåâàëè 1/1000 îáúåìà (2,5 ìêë) ñðåäû SOC íà ñåëåêòèâíóþ ñðåäó ñ àìïèöèëëèíîì (50 ìêã/ìë) äëÿ îïðåäåëåíèÿ êîëè÷åñòâà òðàíñôîðìèðîâàííûõ êëåòîê. Îñòàëüíóþ ÷àñòü ïîìåùàëè â 100 ìë ñðåäû LB ñ àìïèöèëëèíîì (50 ìêã/ìë) è èíêóáèðîâàëè ïðè 37îÑ ïðè ïåðåìåøèâàíèè äî òåõ ïîð, ïîêà îïòè÷åñêàÿ ïëîòíîñòü íå äîñòèãíåò âåëè÷èíû D550=2-2,5. Çàòåì îòáèðàëè 1,6õ1011 êëåòîê, îñàæäàëè èõ öåíòðèôóãèðîâàíèåì, ñóñïåíäèðîâàëè â 4 ìë ñðåäû LB è ïåðåìåøèâàëè ñ 4 ìë ãëèöåðèíà. Ïîëó÷åííóþ áèáëèîòåêó õðàíèëè ïðè -70îÑ.

ÏÎËÈÌÅÐÀÇÍÀß ÖÅÏÍÀß ÐÅÀÊÖÈß

Ðåàêöèîííàÿ ñìåñü ïîëèìåðàçíîé öåïíîé ðåàêöèè (ÏÖÐ) ñîäåðæàëà ñëåäóþùèå êîìïîíåíòû:

100 íã ÄÍÊ ìàòðèöû,

100 íã íåâûðîæäåííîãî ïðàéìåðà,

500 íã âûðîæäåííîãî ïðàéìåðà,

5 ìêë 2 ìÌ ðàñòâîðà äÍTÔ,

5 ìêë 1-êðàòíîãî áóôåðà (10 ìÌ òðèñ-HCl, ðÍ 8,8, 50 ìÌ KCl, 1,5 ìÌ MgCl2, 0,001% æåëàòèí),

1 ìêë Taq ïîëèìåðàçû,

âîäà äî êîíå÷íîãî îáúåìà 50 ìêë (Dieffenbach and Dveksler, 1995).

Òåìïåðàòóðíûé ðåæèì ÏÖÐ.

Ðåàêöèîííóþ ñìåñü èíêóáèðîâàëè ïðè 95îÑ â òå÷åíèå 5 ìèí, ïîñëå ÷åãî äîáàâëÿëè Taq ïîëèìåðàçó è èñïîëüçîâàëè òåìïåðàòóðíûé ðåæèì, ïðè êîòîðîì â òå÷åíèå ïåðâûõ 18 öèêëîâ òåìïåðàòóðó îòæèãà ïðàéìåðîâ ïîíèæàëè íà 3îÑ ÷åðåõ êàæäûå òðè öèêëà:

1é-18é öèêëû 95îÑ - 1 ìèí (äåíàòóðàöèÿ ÄÍÊ),

50-35îÑ - 1 ìèí (îòæèã ïðàéìåðîâ),

72îÑ - 2 ìèí (ïîëèìåðèçàöèÿ).

19-30 öèêëû: 95îÑ - 1 ìèí,

50îÑ - 1 ìèí,

72îÑ - 2 ìèí.

31 öèêë: 95îÑ - 1 ìèí,

50îÑ - 1 ìèí,

72îÑ - 10 ìèí.

ÑÓÁÊËÎÍÈÐÎÂÀÍÈÅ ÄÍÊ

Ôðàãìåíòû ÄÍÊ, ïîëó÷åííûå â ðåçóëüòàòå ÏÖÐ, ðàçäåëÿëè â 1% àãàðîçíîì ãåëå è âûäåëÿëè êàê îïèñàíî â ï. Âûäåëåíèå ÄÍÊ èç ãåëÿ. Çàòåì îñàæäàëè ÄÍÊ ýòàíîëîì, ðàñòâîðÿëè â 5-10 ìêë âîäû è äîáàâëÿëè êîìïîíåíòû äëÿ óäàëåíèÿ âûñòóïàþùèõ íóêëåîòèäîâ ñ 3' êîíöà ÄÍÊ:

1 ìêë 10-êðàòíîãî áóôåðà (200 ìÌ òðèñ-HCl, ðÍ 8,2, 100 ìÌ KÑl, 60 ìÌ (NH4)2SO4, 20 ìÌ MgCl2, 1% òðèòîí Õ-100 è 100 ìêã/ìë áû÷èé ñûâîðîòî÷íûé àëüáóìèí),

1 ìêë 10 ìÌ dÍTÔ,

1 ìêë Pfu ÄÍÊ ïîëèìåðàçû (2,5 å.à./ìêë),

âîäó äî êîíå÷íîãî îáúåìà 10 ìêë.

Ñìåñü èíêóáèðîâàëè 30 ìèí ïðè 72îÑ ïîñëå ÷åãî îõëàæäàëè äî 0îÑ è äîáàâëÿëè êîìïîíåíòû äëÿ ñøèâêè ñ âåêòîðîì pBluescript KS(+) ïî ñàéòó ðåñòðèêöèè Sma I:

1 ìêë ðàñùåïëåííîãî âåêòîðà (0,5 ìêã),

1 ìêë 10-êðàòíîãî áóôåðà (50 ìÌ òðèñ-HCl, ðÍ 7,5, 7 ìÌ MgCl2, 1 ìÌ ÄÒÒ),

1 ìêë 10 ìÌ äATÔ,

1 ìêë ÄÍÊ ëèãàçû ôàãà Ò4 è âîäó äî êîíå÷íîãî îáúåìà 10 ìêë.

Ñìåñü èíêóáèðîâàëè îäíè ñóòêè ïðè êîìíàòíîé òåìïåðàòóðå è çàòåì èñïîëüçîâàëè äëÿ õèìè÷åñêîé òðàíñôîðìàöèè êëåòîê E.coli. Òðàíñôîðìèðîâàííûå êëåòêè âûñåâàëè íà ñåëåêòèâíóþ ñðåäó: 1,5% LB-àãàð ñ àìïèöèëëèíîì (50 ìêã/ìë), òåòðàöèêëèíîì (15 ìêã/ìë), ÈÏÒà (2 ìÌ), X-Gal (500 ìêã/ìë) è èíêóáèðîâàëè 14 ÷àñîâ ïðè 37îÑ. Ïîñëå ýòîãî îòáèðàëè êîëîíèè áåëîãî öâåòà (Ìàíèàòèñ è äð., 1984; Dieffenbach and Dveksler, 1995).

ÑÊÐÈÍÈÍà ÁÈÁËÈÎÒÅÊÈ êÄÍÊ

Áèáëèîòåêó êÄÍÊ âûñåâàëè íà ÷àøêè Ïåòðè ñ 1,5% LB-àãàðîì ñ àìïèöèëëèíîì (50 ìêã/ìë) èç ðàñ÷åòà 4000 êîëîíèé íà ÷àøêó è èíêóáèðîâàëè ïðè 37îÑ äî òåõ ïîð ïîêà êîëîíèè íå äîñòèãíóò 0,5-1 ìì â äèàìåòðå. Êîëîíèè ïåðåíîñèëè íà íåéëîíîâóþ ìåìáðàíó è èíêóáèðîâàëè ïðè êîìíàòíîé òåìïåðàòóðå â äåíàòóðèðóþùåì ðàñòâîðå (0,5 Ì NaOH, 1,5 Ì NaCl) â òå÷åíèå 7 ìèí è äâà ðàçà ïî 2 ìèí â íåéòðàëèçóþùåì ðàñòâîðå (1,5 Ì NaCl, 0,5 Ì òðèñ-HCl, ðÍ 7,5). Çàòåì ñïîëàñêèâàëè ìåìáðàíó â 2-êðàòíîì áóôåðå SSC (0,3 Ì NaCl, 0,03 Ì öèòðàò íàòðèÿ), âûñóøèâàëè è ôèêñèðîâàëè ÄÍÊ â òå÷åíèå 10 ìèí óëüòðàôèîëåòîâûì èçëó÷åíèåì ñ äëèíîé âîëíû 310 íì. Ïîñëå ýòîãî ìåìáðàíó ïîìåùàëè â 50 ìë ïðåäãèáðèäèçàöèîííîãî ðàñòâîðà (ðàñòâîð 1), ñîäåðæàùåãî:

6-êðàòíûé SSC (0.9 Ì NaCl, 0,09 Ì öèòðàò íàòðèÿ),

5-êðàòíûé ðàñòâîð Äåíõàðäòà (0,1% áû÷èé ñûâîðîòî÷íûé àëüáóìèí, 0,1% ôèêîë, 0,1% ïîëèâèíèëïèðîëèäîí),

0,5% SDS,

10% äåêñòðàí ñóëüôàò,

500 ìêã äåíàòóðèðèðîâàííîé ÄÍÊ öûïëåíêà,

è èíêóáèðîâàëè 1 ÷àñ ïðè 55îÑ. Ïîñëå ýòîãî äîáàâëÿëè ìå÷åíóþ 32P-äATÔ ÄÍÊ çîíäà è èíêóáèðîâàëè 12-18 ÷àñîâ ïðè 55îÑ ïðè ïîñòîÿííîì ïîêà÷èâàíèè.

Ïîñëå ãèáðèäèçàöèè ïðîâîäèëè ïðîìûâàíèå ìåìáðàíû äâà ðàçà ïî 10 ìèí â 200 ìë 2-êðàòíîãî SSC + 0,1% SDS ïðè êîìíàòíîé òåìïåðàòóðå, 15 ìèí â 1-êðàòíîì SSC + 0,1% SDS% ïðè 55îÑ è äâà ðàçà ïî 10 ìèí â 0,1-êðàòíîì SSC + 0,1% SDS ïðè 55îÑ. Ýêñïîíèðîâàíèå ïðîâîäèëîñü â òå÷åíèå 12 ÷àñîâ ïðè -70îÑ ñ ðåíòãåíîâñêîé ïëåíêîé (Ìàíèàòèñ è äð., 1984).

ÎÏÐÅÄÅËÅÍÈÅ ÍÓÊËÅÎÒÈÄÍÎÉ ÏÎÑËÅÄÎÂÀÒÅËÜÍÎÑÒÈ ÄÍÊ

Íóêëåîòèäíóþ ïîñëåäîâàòåëüíîñòü ÄÍÊ îïðåäåëÿëè ïî ìåòîäó Ñýíãåðà (Sanger et al., 1977). 5 ìêã ïëàçìèäíîé ÄÍÊ, î÷èùåíîé ãåëü-ôèëüòðàöèåé íà êîëîíêå ñ áèîãåëåì Ï-10, äåíàòóðèðîâàëè â 50 ìêë 0.2 Ì NaOH ïðè 37îÑ â òå÷åíèå 30 ìèí, çàòåì äîáàâëÿëè 5 ìêë 3 Ì NaAc, ðÍ 5,1, äâîéíîé îáúåì ýòàíîëà è èíêóáèðîâàëè 30 ìèí ïðè òåìïåðàòóðå -70îÑ. Ïîñëå ýòîãî îñàæäàëè ÄÍÊ öåíòðèôóãèðîâàíèåì ïðè 12000 g â òå÷åíèå 12 ìèí è ïðîìûâàëè îñàäîê 100 ìêë 80% ýòàíîëà. Îñàäîê ÄÍÊ âûñóøèâàëè ïðè êîìíàòíîé òåìïåðàòóðå è ðàñòâîðÿëè â 7,5 ìêë âîäû, äîáàâëÿëè 2 ìêë 5-êðàòíîãî áóôåðà (200 ìÌ òðèñ-HCl, ðÍ 7,5, 100 ìÌ MgCl2, 250 ìÌ NaCl), 0,5 ìêë ïðàéìåðà (50 íã) è èíêóáèðîâàëè 30 ìèí ïðè 37îÑ. Ïîñëå ýòîãî ïðîáèðêó ïîìåùàëè â ëåä è äîáàâëÿëè 1 ìêë 0,1 Ì ÄÒÒ, 2 ìêë 1,5 ìêÌ äÍTÔ áåç äATÔ, 0,5 ìêë ðàñòâîðà 35S-äATÔ è 2 ìêë ÄÍÊ ïîëèìåðàçû ôàãà Ò7 (2,5 å.à./ìêë). Çàòåì èíêóáèðîâàëè 3 ìèí ïðè 20îÑ è ñðàçó îòáèðàëè ïî 3,5 ìêë â ÷åòûðå ïðîáèðêè, êàæäàÿ èç êîòîðûõ ñîäåðæàëà ïî 2,5 ìêë 80 ìêÌ ñìåñè ÷åòûðåõ äÍTÔ, 50 ìÌ NaCl è 8 ìêÌ îäíîãî èç ääÍTÔ. Èíêóáèðîâàëè 5 ìèí ïðè 37îÑ è äîáàâëÿëè ïî 4 ìêë ñòîï-ðàñòâîðà (95% ôîðìàìèä, 20 ìÌ Na2ÝÄÒÀ, 0,05% áðîìôåíîëîâûé ñèíèé, 0,05% êñèëåí öèàíîë). Ïîëó÷åííûå îáðàçöû èíêóáèðîâàëè 3 ìèí ïðè 100îÑ, áûñòðî îõëàæäàëè äî 0îÑ è îòáèðàëè ïî 2 ìêë äëÿ ýëåêòðîôîðåçà â äåíàòóðèðóþùåì ïîëèàêðèëàìèäíîì ãåëå, èìåþùåì ñîñòàâ:

6% àêðèëàìèä,

8 Ì ìî÷åâèíà,

1-êðàòíûé ãëèöåðèí-òîëåðàíòíûé áóôåð (1,1% òðèñ, 0,36% òàóðèí, 0,02% Na2ÝÄÒÀ).

Ýëåêòðîôîðåç ïðîâîäèëè ïðè íàïðÿæåíèè 40 Â/ñì. Çàòåì ãåëü âûäåðæèâàëè 30 ìèí â 10% óêñêñíîé êèñëîòå, âûñóøèâàëè è ýêñïîíèðîâàëè 12 ÷àñîâ ïðè êîìíàòíîé òåìïåðàòóðå ñ ðåíòãåíîâñêîé ïëåíêîé (Ìàíèàòèñ è äð., 1984).

ÑÀÓÇÅÐÍ ÁËÎÒ ÃÈÁÐÈÄÈÇÀÖÈß

10 ìêã ãåíîìíîé ÄÍÊ, âûäåëåííîé èç ïå÷åíè ñòåðëÿäè, èíêóáèðîâàëè â òå÷åíèå 2 ÷àñîâ ñ ýíäîíóêëåàçàìè ðåñòðèêöèè Pst I è Pvu II (ïî 50 å.à.) ïðè 37îÑ â áóôåðå, ñîäåðæàùåì 100 ìÌ NaCl, 10 ìÌ òðèñ-HCl, ðÍ 7,5, 10 ìÌ MgCl2, 100 ìêã/ìë áû÷èé ñûâîðîòî÷íûé àëüáóìèí, 6 ìÌ 2-ìåðêàïòîýòàíîë. Çàòåì ýêñòðàãèðîâàëè ÄÍÊ ïîñëåäîâàòåëüíî ðàâíûìè îáúåìàìè ôåíîë-õëîðîôîðìà (1:1) è õëîðîôîðìà, îñàæäàëè ÄÍÊ äâóìÿ îáúåìàìè ýòàíîëà, ðàñòâîðÿëè â âîäå è íàíîñèëè íà 1% àãàðîçíûé ãåëü. Ýëåêòðîôîðåç ïðîâîäèëè ïðè íàïðÿæåíèè 1 Â/ñì è òåìïåðàòóðå 12îÑ â òå÷åíèå 12 ÷àñîâ. Çàòåì ãåëü èíêóáèðîâàëè ïðè êîìíàòíîé òåìïåðàòóðå 30 ìèí â 0,25 Ì HCl, 30 ìèí â äåíàòóðèðóþùåì ðàñòâîðå (0,5 Ì NaOH, 1,5 M NaCl) è 10-15 ìèí â ðàñòâîðå 1 (0,25 Ì NaOH, 1,5 M NaCl). Ïîñëå ýòîãî ÄÍÊ ïåðåíîñèëè íà íåéëîíîâóþ ìåìáðàíó ìåòîäîì âàêóóìíîãî ïåðåíîñà â ðàñòâîðå 1. Ìåìáðàíó ñïîëàñêèâàëè â 2-êðàòíîì SSC, âûñóøèâàëè è ôèêñèðîâàëè ÄÍÊ â òå÷åíèå 10 ìèí óëüòðàôèîëåòîâûì èçëó÷åíèåì ñ äëèíîé âîëíû 310 íì.

Ïðåäãèáðèäèçàöèþ ïðîâîäèëè ïðè 55îÑ â òå÷åíèå 1 ÷àñà â ðàñòâîðå 1 (ñì. Ñêðèíèíã áèáëèîòåêè êÄÍÊ). Ãèáðèäèçàöèÿ äëèëàñü 12-16 ÷àñîâ ïðè 55îÑ ñ êîíöåíòðàöèåé çîíäà íå áîëåå 10 íã/ìë.

Îòìûâêó ïðîâîäèëè äâà ðàçà ïî 10 ìèí â 2-êðàòíîì SSC + 0,1% SDS ïðè êîìíàòíîé òåìïåðàòóðå è îäèí ðàç 15 ìèí â 1-êðàòíîì SSC + 0,1% SDS ïðè 55îÑ. Ýêñïîíèðîâàíèå äëèëîñü 12 ÷àñîâ ïðè -70îÑ (Ìàíèàòèñ è äð., 1984).

ÐÅÇÓËÜÒÀÒÛ

ÊÎÍÑÒÐÓÈÐÎÂÀÍÈÅ ÁÈÁËÈÎÒÅÊÈ êÄÍÊ È ÅÅ ÑÊÐÈÍÈÍÃ

 êà÷åñòâå èñòî÷íèêà ìÐÍÊ áðàëè ëåéêîöèòû ïåðèôåðè÷åñêîé êðîâè ñòåðëÿäè. Íà îñíîâå ýòîé ìÐÍÊ ñèíåçèðîâàëè êÄÍÊ. Ïîëó÷åííûå ìîëåêóëû êÄÍÊ êëîíèðîâàëè â ïëàçìèäíîì âåêòîðå pBluescript KS(+), ïîñëå ÷åãî òðàíñôîðìèðîâàëè ýòèì âåêòîðîì êëåòêè E.coli øòàììà XL-1 Blue MRF’.  ðåçóëüòàòå ýòîãî áûëà ïîëó÷åíà áèáëèîòåêà êÄÍÊ ïðåäñòàâèòåëüíîñòüþ 6 ìèëëèîíîâ êëîíîâ. Áèáëèîòåêó àìïëèôèöèðîâàëè äî îáúåìà 5 õ 1011 êëåòîê.

Cóììàðíóþ ïëàçìèäíóþ ÄÍÊ áèáëèîòåêè âûäåëÿëè è èñïîëüçîâàëè â ÏÖÐ ñ ïàðîé ïðàéìåðîâ, îäèí èç êîòîðûõ ãîìîëîãè÷íåí ó÷àñòêó âåêòîðà âáëèçè ñàéòà êëîíèðîâàíèÿ ìîëåêóëû êÄÍÊ è ðàñïîëàãàåòñÿ â êîäèðóþùåé îðèåíòàöèè. Âòîðîé ïðàéìåð âûðîæäåííûé, ñîîòâåòñòâóþùèé íàèáîëåå êîíñåðâàòèâíîìó ó÷àñòêó ïîñëåäîâàòåëüíîñòè J-ñåãìåíòîâ L-öåïåé Èà ïîçâîíî÷íûõ â íåêîäèðóþùåé îðèåíòàöèè (ðèñ. 10).

Îäèí èç ôðàãìåíòîâ ÄÍÊ, ïîëó÷åííûõ â ðåçóëüòàòå ÏÖÐ, ñîîòâåòñòâîâàë îæèäàåìîìó ðàçìåðó (370 ïí). Ýòîò ôðàãìåíò âûäåëÿëè è ñóáêëîíèðîâàëè â âåêòîðå pBluescript KS(+). Îïðåäåëåíèå íóêëåîòèäíîé ïîñëåäîâàòåëüíîñòè ýòîãî ôðàãìåíòà ïîêàçàëî, ÷òî îí ãîìîëîãè÷åí ãåíàì V îáëàñòè L-öåïåé Èà (Ðèñ. 11).

Ýòîò ôðàãìåíò áûë èñïîëüçîâàí â êà÷åñòâå çîíäà äëÿ ñêðèíèíãà áèáëèîòåêè êÄÍÊ ëåéêîöèòîâ ñòåðëÿäè. Ñêðèíèíã 4000 êîëîíèé áèáëèîòåêè êÄÍÊ â ìÿãêèõ óñëîâèÿõ ãèáðèäèçàöèè ïîçâîëèë âûÿâèòü ïÿòü êëîíîâ ñ ðàçìåðîì âñòàâêè êÄÍÊ îò 800 äî 1050 ïí. Äëÿ ÷åòêîãî ðàçäåëåíèÿ êëîíîâ ïðîâîäèëè âòîðè÷íûé ñêðèíèíã áèáëèîòåêè êÄÍÊ, ïîñëå ÷åãî âûäåëåííûå êëîíû àìïëèôèöèðîâàëè.








ïðàìåð Ò3

5'-GCAATTAACCCTCACTAAAGG-3';

J-ïðàéìåð

5'-A(G/C)(T/C)(T/C)TGGT(T/G/C)CCTTTTCC(A/G)AA-3’

Ðèñ. 10. Ñõåìà ÏÖÐ. Ò3 ïðàéìåð ðàñïîëàãàåòñÿ âáëèçè ñàéòà êëîíèðîâàíèÿ ìîëåêóëû êÄÍÊ è êîìïëèìåíòàðåí íåêîäèðóþùåé öåïè, J-ïðàéìåð ãîìîëîãè÷åí ó÷àñòêó êîäèðóþùåé öåïè J-ñåãìåíòà ãåíîâ L-öåïåé Èà ïîçâîíî÷íûõ. Îæèäàåìàÿ äëèíà ïðîäóêòîâ îêîëî 400 ïí.

ÎÏÐÅÄÅËÅÍÈÅ ÏÅÐÂÈ×ÍÎÉ ÑÒÐÓÊÒÓÐÛ

Îïðåäåëåíà íóêëåîòèäíàÿ ïîñëåäîâàòåëüíîñòü âñòàâêè êÄÍÊ êëîíà Â1. êÄÍÊ êëîíà Â1 ðàçìåðîì 1050 ïí ïðåäñòàâëÿëà ñîáîé ïîëíîðàçìåðíóþ êîïèþ çðåëîãî ãåíà L-öåïè Èà è ñîäåðæàëà 5’-íåòðàíñëèðóåìóþ îáëàñòü, ïîñëåäîâàòåëüíîñòü êîäèðóþùóþ ëèäåðíûé ïåïòèä, V îáëàñòü, Ñ îáëàñòü, à òàêæå 3’-íåòðàíñëèðóåìóþ îáëàñòü (Ðèñ. 11). Íà îñíîâå ïåðâè÷íîé ñòðóêòóðû êëîíà Â1 ñêîíñòðóèðîâàëè è ñèíòåçèðîâàëè òðè ïðàéìåðà, ñîîòâåòñòâóþùèõ êîíñåðâàòèâíûì ðàéîíàì V è C îáëàñòè è èñïîëüçîâàëè èõ äëÿ îïðåäåëåíèÿ íóêëåîòèäíîé ïîñëåäîâàòåëüíîñòè êëîíîâ Å4 è Ñ2. Ïîñëåäîâàòåëüíîñòü êëîíà Å4 áûëà îïðåäåëåíà òîëüêî â îáëàñòè, ïðèìûêàþùåé ê Ò3 ïðîìîòîðó âåêòîðà. Çà èñêëþ÷åíèåì 2 íóêëåîòèäîâ îíà ïîëíîñòüþ èäåíòè÷íà ïîñëåäîâàòåëüíîñòè Â1. Ïîñëåäîâàòåëüíîñòü êëîíà Ñ2 èìåëà õèìåðíûé õàðàêòåð.  îáëàñòè Ò3 ïðîìîòîðà îíà ñîäåðæàëà ôðàãìåíò ñîîòâåòñòâóþùèé 3’ ÷àñòè Ñ ñåãìåíòà êëîíà B1 ñ çàìåíàìè íåñêîëüêèõ íóêëåîòèäîâ.  òî æå âðåìÿ èñïîëüçîâàíèå äëÿ îïðåäåëåíèÿ ïîñëåäîâàòåëüíîñòè ïðàéìåðîâ V è C îáëàñòè ïîêàçàëî, ÷òî ýòà âñòàâêà ñîäåðæèò äîïîëíèòåëüíî ïåðåñòðîåííûé ãåí ëåãêîé öåïè, ñîäåðæàùèé áîëüøóþ ÷àñòü V ñåãìåíòà è âòîðîé Ñ ñåãìåíò, îòëè÷àþùèéñÿ îò ïåðâîãî â îäíîé ïîçèöèè. Ïîñêîëüêó ïîêà íå óäàëîñü îïðåäåëèòü ïîñëåäîâàòåëüíîñòü â îáëàñòè ñòûêà ýòèõ äâóõ ôðàãìåíòîâ âñòàâêè, íåëüçÿ ñêàçàòü, íàõîäÿòñÿ ëè îíè â îäíîé èëè ðàçíûõ îðèåíòàöèÿõ. Ïî-âèäèìîìó, ñõîäíûé õèìåðíûé õàðàêòåð èìååò ïîñëåäîâàòåëüíîñòü êëîíà D2 (äàííûå íå ïîêàçàíû).

ÑÐÀÂÍÈÒÅËÜÍÛÉ ÀÍÀËÈÇ ÏÅÐÂÈ×ÍÎÉ ÑÒÐÓÊÒÓÐÛ

Íóêëåîòèäíóþ è ïðåäñêàçàííûå àìèíîêèñëîòíûå ïîñëåäîâàòåëüíîñòè êëîíà Â1 ñðàâíèâàëè ñ ïîñëåäîâàòåëüíîñòÿìè V è C ãåíîâ L-öåïåé Èà äðóãèõ âèäîâ ïîçâîíî÷íûõ (Ðèñ 12). Íà àìèíîêèñëîòíîì óðîâíå V îáëàñòü èìååò íàèáîëüøåå ñõîäñòâî ñ V-îáëàñòÿìè L-öåïåé êëàññà F è G ïåùåðíîãî ñîìèêà è ñ V-îáëàñòüþ L1 êëàññà Èà ôîðåëè (63-71%). È òå è äðóãèå îòíîñÿòñÿ ê êàïïà-òèïó L-öåïåé. Ïðè ïîèñêå ãîìîëîãîâ â ïîëíîì áàíêå ïîñëåäîâàòåëüíîñòåé Èà ìëåêîïèòàþùèõ ïåðâûå 100 ïîçèöèé ñ íàèáîëüøèì ñõîäñòâîì ïðåäñòàâëÿëè ñîáîé òàêæå V êàïïà îáëàñòè.

Ñ-îáëàñòü êëîíà Â1 èìååò íà àìèíîêèñëîòíîì óðîâíå ïðèáëèçèòåëüíî îäèíàêîâîå è íå î÷åíü çíà÷èòåëüíîå ñõîäñòâî ñ øèðîêèì ñïåêòðîì Ñ-îáëàñòåé L-öåïåé Èà õðÿùåâûõ è êîñòèñòûõ ðûá (41-44%). Íà íóêëåîòèäíîì óðîâíå íàèáîëåå áëèçêèìè ãîìîëîãàìè Â1Ñ ãåíà ÿâëÿþòñÿ ãåíû III êëàññà õðÿùåâûõ ðûá (65%).

ÀÍÀËÈÇ ÃÅÍÎÌÍÎÉ ÎÐÃÀÍÈÇÀÖÈÈ

Ãåíîìíóþ îðãàíèçàöèþ ëîêóñà ãåíîâ L-öåïåé Èà ñòåðëÿäè îöåíèâàëè ìåòîäîì Ñàóçåðí áëîò ãèáðèäèçàöèè. Ãåíîìíóþ ÄÍÊ âûäåëÿëè èç ïå÷åíè ñòåðëÿäè. ÄÍÊ ðàñùåïëÿëè ýíäîíóêëåàçàìè ðåñòðèêöèè Pst I è Pvu II. Ïîñëå ýëåêòðîôîðåòè÷åñêîãî ðàçäåëåíèÿ è ïåðåíîñà ôðàãìåíòîâ ÄÍÊ íà íèòðîöåëëþëîçíóþ ìåìáðàíó ïðîâîäèëè ãèáðèäèçàöèþ â ìÿãêèõ óñëîâèÿõ.  êà÷åñòâå çîíäà íà V-ãåíû èñïîëüçîâàëè ôðàãìåíò, ïîëó÷åííûé â ðåçóëüòàòå ÏÖÐ (ñì. Êîíñòðóèðîâàíèå áèáëèîòåêè êÄÍÊ è åå ñêðèíèíã).  êà÷åñòâå Ñ-çîíäà èñïîëüçîâàëè ó÷àñòîê êÄÍÊ êëîíà Â1, êîäèðóþùèé CL ñåãìåíò, êîòîðûé âûðåçàëè ïî ñàéòàì ðåñòðèêöèè ýíäîíóêëåàçàìè EcoR V-Xho I.

V-çîíä âûÿâëÿë áîëåå 20 ãèáðèäèçóþùèõñÿ ôðàãìåíòîâ ÄÍÊ, â òî âðåìÿ êàê Ñ-çîíä ãèáðèäèçîâàëñÿ òîëüêî ñ 3-4 ôðàãìåíòàìè (ðèñ. 13).

5' íåòðàíñëèðóåìàÿ îáëàñòü |> ëèäåðíûé ïåïòèä

1 15 30 45 60 75 90

B1 . .TTCATGGCAACA GAATCCACAACAACA ATGACTTTTATCAGC ATCTTCATCTGGGCA CTTGTCATCTGCACT CAGGAATCCAGTGGA

E4 CCC----A------- --------------- --------------- --------------- --------------- ---------------

C2 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

C2(T3) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

PCR . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

|> V ñåãìåíò FR 1 |> CDR 1

105 120 135 150 165 180

B1 CAGTATACTGTGACT CAGACTCCAGCAGAG AAATCTGTTCTCCCA GGAGACACAGTCGCT CTCAACTGTAAAGTC AACAGCGCAGTCCTT

E4 --------------- --------G----T- --------------- ----------. . . . . . . . . . . . . . . . . . .

C2 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

C2(T3) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

PCR . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

|> FR 2 |> CDR 2 |> FR 3

195 210 225 240 255 270

B1V GGTAATACGTACCTG CACTGGTACCAACAG AAACCTGGAGAAGCT CCCAAACTCCTGATC TATAGGGCAAGTACC CTTGAGTCTGGGATC

E4 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

C2 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . ---- ---C-----------

C2(T3) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

PCR . . . . . . . . . . . . . . . . . .------------ -----------A--- ---TAT----T--AG ---C-------N---

285 300 315 330 345 360

B1 CCAACTCGTTTCAGT GGCAGTGGATCTGGG ACTGACTTCACTCTG ACCATCAGTGGAGTC CAGGCTGAAGATGAA GGAGATTACTACTGT

E4 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

C2 --------C----C- --------------- --------------- --------------- --------------- --------T------

C2(T3) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

PCR --------------- ------------TT- --------------- --------------- -------------C- ---------------

|> CDR 3 |> J ñåãìåíò |> Ñ ñåãìåíò

375 390 405 420 435 450

B1 GTCAGTGTACACTAC TCCAGCAGTAGATAT GTGTTGACTTTCGGG CCCGGGACCAAACTA ATTGTGAAATCTGGA AGCCCCACTGCTCCT

E4 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

C2 CAG---TC------- C----------C-G- -NCC-C--------A --A--------G--G G-------------- -A-------------

C2(T3) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

PCR CAG---CAC---ACT C---ATG . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

465 480 495 510 525 540

B1 TCCTCCGTCTCCCTG CTTCCTCCCTCCAAG CTGGAGCTCGACTCA AAGGGTAAAGCCACC CTGGTCTGCCTGGTG AATAATTTCTACCCT

E4 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

C2 --------------- --------------- ------------A-- -----C--------- TG------------- --------------C

C2(T3) . . . . . . . . . . . . . . . . . . . . . . . . . . -C--------- T-------------- --------------C

PCR . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

555 570 585 600 615 630

B1 GATGTCGTGGATATC AAGTGGACGGTGGAC GGGGTGGCCCAGTCG TCTGGTGTGCTGACC AGCACAATGAAGCAG AAGGATGGGAAATAC

E4 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

C2 --------------- --------------T ----C---------- --------------- --------------- -----C---------

C2(T3) --------------- --------------T ----C---------- --------------- --------------- -----C---------

PCR . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

645 660 675 690 705 720

B1 AGTGCAAGCAGCAGC CTGACCCTCACCAAG GCCGTGTGGAACAGC AAGGAGACATACACC TGCACTGTGAAGCAC GAGGCTGTGAGCACT

E4 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

C2 --------------- --------------- -A------------- --------------- --------------- ---------------

C2(T3) --------------- --------------- -A------------- --------------- --------------- ---------------

PCR . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

|> 3' íåòðàíñëèðóåìàÿ îáëàñòü

735 750 765 780 792

B1 CCCAGGAGCGAGTCC ATCAAGAGGAGCGAG TGCACACTATTAGAT GCCtaaAGG . . . . . . . . .

E4 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

C2 --G----------T- --------------- --------------- ---taaG-CAAGAGA ATCCGTGTGATT

C2(T3) --G----------T- --------------- --------------- . . . . . . . . . . . . . .

PCR . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

Ðèñ. 11. Íóêëåîòèäíàÿ ïîñëåäîâàòåëüíîñòü ïîëíîðàçìåðíîé êÄÍÊ êëîíà Â1 è ÷àñòè÷íàÿ ïîñëåäîâàòåëüíîñòü êÄÍÊ êëîíîâ Å4 è Ñ2 è ïðîäóêòà ÏÖÐ. Ïîñëåäîâàòåëüíîñòü êÄÍÊ êëîíà Ñ2 îïðåäåëÿëàñü ñ èñïîëüçîâàíèå ïðàéìåðîâ V1, V2, C1 (îáîçíà÷åíèå Ñ2) è Ò3 (îáîçíà÷åíèå Ñ2(Ò3)). Ïðî÷åðê îçíà÷àåò èäåíòè÷íîñòü â ýòîé ïîçèöèè ñ êÄÍÊ êëîíà Â1, FR - êàðêàñíûå ó÷àñòêè, CDR - ãèïåðâàðèàáåëüíûå ó÷àñòêè V îáëàñòè.

A

AruIgLBV QYTVTQTPAEKSVLPGDTVALNCKVNSAVLGNTYLHWYQQKPGEAPKLLIY*RASTLESGIPTRFSGSG**SGTDFTLTISGVQAEDEGDYYCVSV

IpuIgLVG -V-------V--A---E--TI--RT-P-Y*-H*-----------------K*F-NQ-H----A------**--S----------T--A-----Q-Y 71%

OmyIgLV1 -I------EM-AFQT--A-T-R-RF-KPSPPC**VA-------G--Q----*Y-T--Q--T-S------**--S-------------A-----Q-Y 63%

XIaIgLVR -VVL--S-DYV--S--E--TIT--AS-SS---**-------S-QT------*GT-NRYT-T-E------**----------RME---AA----QQY 58%

Rabbit kV IV ivm----ss---pv----ti--qasqs-ys-nr-a-f-----qp------*k----a--v-s--k---**---q------d--ca-aat---rva 57%

GciIgLVIII -M--S-PVL--GL-Q--TIT-TASQS-YS-**-A----RE-QK-S----*A-TNRYTEVSE------**---S-----RN--P--VA----QGT 48%

HulV2 -SAL--*-ASV-GS--QSITIS-TGT-SSYNL**VS----H--K----M--*EG-KRP--VSN-----K**--NTAS--T--L-----A----C-Y 47%

HfrIgLVII GTVL--*--SM-TSQ-K--KIT-TISGGGTYY**SS--W----S--VFVWRDYD--RG----D--T--RNT-SNVMH---TD--SR-TA-----AW 41%

XlaIgLIII -VSI--*-VSE--KL-E--RIS-TLSG-SGYH**VN-----A-NR-RY-LRFYSDSNK**HQD-----KDSPNNIGY---K-ALL--DA----ATW 35%

HfrIgLV1 VPVLN---ISDP-SA-E-SE-K-AMQNGGSYY**MS--R-R-----VFVL**YQ--SG-IYRD--KP-RDT-SNSHI---GSLEPG-SAV---AAN 31%

Á

AruIgLCB GSPTAPSSVSLLPPSKLELDSKGKATLVCLVNNFYPDVVDIKWTVDGVAQSSG*VLTSTMKQK**DGKYSASSSLTLTKAVWNSKETYTCTVKHEAVSTPRSESIKRSECTLLDA

CplIgLCII -RS*PT--V----SDQITA-NM-------SG-V-GAAE-E-----SVRGN-*-E--RIQ-EA*-NTF-V--Y---SASD---H-L-S-V-K-ETQAN-LQT--S--S-M 44%

HfrIgLCIII EKSQPTLT-M---PE-VKA--T------ADH----E-GVE-KK--A-I-A-*-Q--NYLRAS*-ST--C--L---SGSD-E-NARFS-ALT-ETL-S-L-K-VS----V 42%

IpuIgLCF G--VKP-----L--S-Q-S*E-S-S-L--LPAYS-QGALVS-----SEVKD-*----AEER-**TDG-TR--T---S--L-EKG-EFV-K-S-DN-DH-VT**FRK-Q-EV 41%

Hu kappa TV-AP-VFIF---*D-QLKS-T-SV---L-----REAKVQ-K--NAL--GN*SQE-VTE-DSK-ST--L--T---S--DYEKHKV-A-E-T-QGL-S-VTK-FN-G-- 39%

XlaIgLC3 GDVK--*---YF---*V-EIATK---V--SLSD-T-RGATVK-L---KD-TDS*-QS-GLSKQS*-NL-ME--Y-S--ADQ-LRH---S-K-S-Q**GKEIIQTL-----V 38%

Hu lambda1 Q-K-NPT-T-F---*S-ELQAN-------ISD---GA-TVA-KA--SPVKA-*-E-TKPSKQS*NN--A---Y-S--PEQ-K-HRS-S-Q-T-E**GSTVEKTVAPT--S 37%

HfrIgLCI SEDRKP-VL-----*S-EIDS-W---S---SR-K-GF-RVL-R--DKETD--*-T-G-VSTDS*-QS--L--YLRVPATA--KGSS---S-D-GSL-S-LLKT-SSTA-SD 37%

XlaIgLCS ND-KPA-FIFK--*D-QVKE-NP-A---I---F-RDLTVT-K--SQDV--SD-K--DFM-ES*-ST--Q--M-T---DK-DKADKFE-L-K-K**TAQLTQSFSK-Q-S 34%

IpuIgLCG LTQP--TV----SV--Q*QE-V-----AYKGF-SDWRLS-K---SSW---*ESR-SAVLQA*--L--W--T-S-HPEQ-RN-*VV--EASKDN*QP-VVSTVNTEQ- 33%

Ðèñ. 12. Ñðàâíåíèå àìèíîêèñëîòíûõ ïîñëåäîâàòåëüíîñòåé V (À) è Ñ (Á) îáëàñòåé L-öåïè Èà ñòåðëÿäè ñ ïîñëåäîâàòåëüíîñòÿìè äðóãèõ âèäîâ ïîçâîíî÷íûõ. Äåôèñ îáîçíà÷àåò èäåíòè÷íîñòü â äàííîé ïîçèöèè. Çâåçäî÷êà îáîçíà÷àåò äåëåöèþ àìèíîêèñëîòíûõ îñòàòêîâ. Ñëåâà óêàçàíû ïðîöåíòû ñõîäñòâà. Âèäîâûå îáîçíà÷åíèÿ: Aru - ñòåðëÿäü, Ipu - ïåùåðíûé ñîìèê, Omy - ðàäóæíàÿ ôîðåëü, Xla - øïîðöåâàÿ ëàãóøêà, Gci - àêóëà-íÿíüêà, Hu - ÷åëîâåê, Cpl - ïåñ÷àíàÿ àêóëà, Hfr - ðàçíîçóáàÿ àêóëà.

Ðèñ. 13. Ñàóçåðí áëîò ãèáðèäèçàöèÿ. Ãåíîìíàÿ ÄÍÊ áûëà âûäåëåíà èç ïå÷åíè è îáðàáîòàíà ýíäîíóêëåàçàìè ðåñòðèêöèè Pst I Pvu II. Ãèáðèäèçàöèþ ïðîâîäèëè â ìÿãêèõ óñëîâèÿõ ñ èñïîëüçîâàíèåì çîíäîâ, ãîìîëîãè÷íûõ VL (à) è CL (á) ãåííûì ñåãìåíòàì L-öåïåé Èà ñòåðëÿäè. Ñ V-çîíäîì ãèáðèäèçîâàëîñü áîëåå 20 ôðàãìåíòîâ ÄÍÊ, â òî âðåìÿ êàê ñ Ñ-çîíäîì ãèáðèäèçîâàëîñü òîëüêî 3-4 ôðàãìåíòà.

ÎÁÑÓÆÄÅÍÈÅ ÐÅÇÓËÜÒÀÒÎÂ

 ðåçóëüòàòå ïðîâåäåííîé ðàáîòû èäåíòèôèöèðîâàí ëîêóñ ãåíîâ, êîäèðóþùèõ L-öåïè Èà ñòåðëÿäè, ïðåäñòàâèòåëÿ ïîäêëàññà êîñòíî-õðÿùåâûõ ðûá. Ñðàâíèòåëüíûé àíàëèç ñòðóêòóðû V ãåíîâ ýòîãî ëîêóñà óêàçûâàåò, ÷òî îí îòíîñèòñÿ ê êàïïà òèïó. Ðåçóëüòàòû ñðàâíèòåëüíîãî àíàëèçà Ñ îáëàñòåé ìåíåå èíôîðìàòèâíû, ÷òî ñàìî ïî ñåáå íå óäèâèòåëüíî, òàê êàê Ñ-ãåíû L-öåïåé Èà çíà÷èòåëüíî ìåíåå êîíñåðâàòèâíû ÷åì V-ãåíû. Òåì íå ìåíåå, òîò ôàêò, ÷òî íà íóêëåîòèäíîì óðîâíå Ñ-ãåí ñòåðëÿäè èìååò íàèáîëüøåå ñõîäñòâî ñ êàïïà-ïîäîáíûìè ãåíàìè III êëàññà õðÿùåâûõ ðûá, òàêæå ñâèäåòåëüñòâóåò î òîì, ÷òî îáíàðóæåííûé ëîêóñ îòíîñèòñÿ ê êàïïà òèïó.

êÄÍÊ êëîíîâ Â1, Ñ2, Å4, à òàêæå ôðàãìåíò, ïîëó÷åííûé ñ ïîìîùüþ ÏÖÐ, ñîäåðæàò áëèçêîðîäñòâåííûå V-ãåíû. Ðàçëè÷èÿ ìåæäó íèìè ñêîíöåíòðèðîâàíû â îñíîâíîì â îáëàñòè 3-ãî ãèïåðâàðèàáåëüíîãî ðàéîíà. Ïîñëåäîâàòåëüíîñòè äâóõ îáíàðóæåííûõ J-ñåãìåíòîâ îòëè÷àþòñÿ ïî 10 íóêëåîòèäàì, ò.å., îíè ïðåäñòàâëÿþò ñîáîé ðàçëè÷íûå ãåíîìíûå ñåãìåíòû. Íåçíà÷èòåëüíûå ðàçëè÷èÿ îáíàðóæåíû òàêæå ìåæäó òðåìÿ ïîñëåäîâàòåëüíîñòÿìè Ñ-ãåíîâ. Ñ-ñåãìåíò êëîíà Â1 îòëè÷àåòñÿ îò ïîëíîãî Ñ-ñåãìåíòà êëîíà Ñ2 ïî 9 ïîçèöèÿì, èç êîòîðûõ 5 âåäóò ê çàìåíå àìèíîêèñëîòû. Ïî-âèäèìîìó, ýòè ïîñëåäîâàòåëüñòè òàêæå ïðåäñòàâëÿþò ñîáîé ðàçíûå çàðîäûøåâûå ãåíû.

Àíàëèç ñòðóêòóðíîé îðãàíèçàöèè ëîêóñà ñ ïîìîùüþ Ñàóçåðí áëîò-ãèáðèäèçàöèè óêàçûâàåò, ÷òî ó ñòåðëÿäè èìåþòñÿ ìíîæåñòâåííûå VL ãåíû. Òî÷íàÿ îöåíêà èõ êîëè÷åñòâà íåâîçìîæíà, íî íàëè÷èå áîëåå 20 ïîëîñ ãèáðèäèçàöèè ñ ðàçíîé èíòåíñèâíîñòüþ ñèãíàëà, ïî àíàëîãèè ñ ìíîãî÷èñëåííûìè ëèòåðàòóðíûìè äàííûìè, ïîçâîëÿåò ãîâîðèòü î íåñêîëüêèõ äåñÿòêàõ êîïèé.

Ïðè èñïîëüçîâàíèè Ñ-çîíäà êîëè÷åñòâî ïîëîñ â ìÿãêèõ óñëîâèÿõ ãèáðèäèçàöèè íå ïðåâûøàåò 4-õ. Ó÷èòûâàÿ âîçìîæíîñòü àëëåëèçìà ìîæíî ãîâîðèòü î íàëè÷èè â ýòîì ëîêóñå 2-4õ ãåíîâ.

ßðêî âûðàæåííîå êîëè÷åñòâåííîå ïðåâîñõîäñòâî V ãåíîâ íàä Ñ-ãåíàìè ÿâëÿåòñÿ õàðàêòåðíûì ïðèçíàêîì ñåãìåíòàðíîé ôîðìû îðãàíèçàöèè ëîêóñà. Ó õðÿùåâûõ è êîñòèñòûõ ðûá ñ êëàñòåðíîé îðãàíèçàöèåé ãåíîâ L-öåïåé êîëè÷åñòâî V è Ñ ãåíîâ î÷åíü âåëèêî è ïðèáëèçèòåëüíî îäèíàêîâî, ÷òî îòðàæàåòñÿ â ñõîäíîé êàðòèíå áëîò-ãèáðèäèçàöèè. Ïîëó÷åííûå íàìè ðåçóëüòàòû ÿâëÿþòñÿ ñåðüåçíûì îñíîâàíèåì äëÿ òîãî, ÷òîáû óòâåðæäàòü, ÷òî ó ñòåðëÿäè îðãàíèçàöèÿ ãåíîâ L-öåïåé êàïïà-ïîäîáíîãî òèïà èìååò ñåãìåíòàðíûé õàðàêòåð, ïîäîáíûé îðãàíèçàöèè êàïïà ëîêóñà ìëåêîïèòàþùèõ.

Ýòè äàííûå óêàçûâàþò íà òî, ÷òî ïåðåõîä îò êëàñòåðíîé ê ñåãìåíòàðíîé îðãàíèçàöèè ïðîèçîøåë â ôèëîãåíåçå ïîçâîíî÷íûõ î÷åíü ðàíî, âîçìîæíî óæå ó äðåâíèõ ïåðâè÷íî-êîñòíûõ.

ÂÛÂÎÄÛ

1. Ñêîíñòðóèðîâàíà áèáëèîòåêà êÄÍÊ ëåéêîöèòîâ ñòåðëÿäè ïðåäñòàâèòåëüíîñòüþ 6õ106 íåçàâèñèìûõ êëîíîâ. ÏÖÐ ÄÍÊ áèáëèîòåêè ñ ïîìîùüþ âûðîæäåííîãî ïðàéìåðà, ñîîòâåñòâóþùåãî J ñåãìåíòó ãåíîâ ÈÃ, ïîçâîëèë âûÿâèòü ôðàãìåíò ÄÍÊ äëèíîé 370 ïí, ãîìîëîãè÷íûé V ãåíàì Èà ïîçâîíî÷íûõ.

2. Èç áèáëèîòåêè êÄÍÊ ñ èñïîëüçîâàíèåì ïðîäóêòà ÏÖÐ â êà÷åñòâå çîíäà âûäåëåíî ïÿòü êëîíîâ, ñîäåðæàùèõ âñòàâêè êÄÍÊ ãåíîâ L-öåïåé ÈÃ. Ñðàâíèòåëüíûé àíàëèç ïåðâè÷íîé ñòðóêòóðû êÄÍÊ êëîíîâ ïîêàçàë, ÷òî îíè ÿâëÿþòñÿ ÷ëåíàìè îäíîãî ñåìåéñòâà ãåíîâ è èìåþò íàèáîëüøåå ñõîäñòâî ñ ãåíàìè êàïïà òèïà.

3. Ñîãëàñíî ðåçóëüòàì ãåíîìíîãî áëîò-àíàëèçà èäåíòèôèöèðîâàííîå ñåìåéñòâî ñîäåðæèò íåñêîëüêî äåñÿòêîâ V ãåíîâ è òîëüêî 2-4 Ñ ãåíà, ÷òî óêàçûâàåò íà ñåãìåíòàðíóþ ôîðìó åãî îðãàíèçàöèè.

4. Ïîëó÷åííûå äàííûå óêàçûâàþò ÷òî ïåðåõîä îò êëàñòåðíîãî òèïà îðãàíèçàöèè ãåíîâ ÈÃ, õàðàêòåðíîãî äëÿ õðÿùåâûõ ðûá, ê ñåãìåíòàðíîìó, ïðèñóòñòâóþùåìó ó âñåõ ìëåêîïèòàþùèõ, ïðîèçîøåë â ýâîëþöèè â ïåðèîä ïîÿâëåíèÿ ïåðâè÷íî-êîñòíûõ ðûá.

ÑÏÈÑÎÊ ËÈÒÅÐÀÒÓÐÛ

Ìàçèí À. Â., Êóçíåäåëîâ Ê. Ä. è äð. Ìåòîäû ìîëåêóëÿðíîé ãåíåòèêè è ãåííîé èíæåíåðèè. Íîâîñèáèðñê, 1988. 333 ñ.

Ìàíèàòèñ Ò., Ôðè÷ Ý., Ñýìáðóê Ä. Ìîëåêóëÿðíîå êëîíèðîâàíèå. Ì.: Ìèð, 1984. 480 ñ.

Ïîë Ó. (ðåä.) Èììóíîëîãèÿ. Ì.: Ìèð, 1987. Ò. 1. 476 ñ.

Ðîìåð À. Ñ. è Ïàðñîíñ Ò. Ñ. Àíàòîìèÿ ïîçâîíî÷íûõ. Ì.: Ìèð, 1992. 358 ñ.

Ôðèìåëü Ã. (ðåä.) Èììóíîëîãè÷åñêèå ìåòîäû. Ì.: Ìåäèöèíà, 1987. 472 ñ.

Þäêèí È. È. Èõòèîëîãèÿ. Ìîñêâà-Ëåíèíãðàä: Ïèùåïðîìèçäàò, 1941.

Aguilera R. J., Akira S., Okazaki K.,Sakano H. A pre-B cell nuclear protein wich specifically interacts with the immunoglobulin V-J recombination sequeces // Cell. 1987. V. 51. P. 909-917.

Anderson M. K., Shamblott M. J., Litman R. T., Litman G. W. Generation of immunoglobulin light chain gene diversity in Raja erinacea is not associated with somatic rearrangement, an exception to a central paradigm of B cell immunity // Journal of Experimental Medecine. 1995. V. 182. P. 109-119.

Bengten E. The immunoglobulin genes in Atlantic cod (Gadus morhuna) and rainbow trout (Oncorhynchus mykiss) // Dissertations from the Faculty of Science and Technology. 1994. V. 19.

Bengten E., Leanderson T., Pilstrom L. Immunoglobulin heavy chain cDNA from Atlantic cod (Gadus morhuna L.): nucleotide sequences of secretory and membrane form show an unusual splicing pattern // European Journal of Immunology. 1991. V. 21. P. 3027-3033.

Blomberg B., Tonegawa S. DNA sequences of the joining regions of mouse l light chain immunoglobulin genes // Proc. Natl. Acad. Sci. USA. 1982. V. 79. P. 530.

Boyle J. S., Lew A. M. An inexpensive alternative to glassmilk for DNA purification // Trends in Genetics. 1995. V. 11. No. 1. p. 8.

Chomczynski P. and Sacchi N. Single-step method of RNA isolation by acid guanidinum thiocyanate-phenol-chloroform extraction // Analytical biochemistry. 1987. V. 162. P. 156-159.

Daggfeldt A., Bengten E., Pilstrom L. A claster type organization of the loci of the immunoglobulin light chain in Atlantic cod (Gadus morhuna L.) and rainbow trout (Oncorhynchus mykiss Walbaum) indicated by nucleotide sequences of cDNAs and hybridization analysis // Immunogenetics. 1993. V.38. P. 199-209.

Dieffenbach C. W. and Dveksler G. S. (edit). PCR primer. A laboratory manual. New York: Cold Spring Harbor Laboratory Press, 1995. 714 p.

Durdik J., Moore M. W., Selsing E. Novel k light-chain gene rearrangements in mouse l light-chain-producing B limphocytes // Nature. 1984. V. 307. P. 749-752.

Flajnik M. F. The immune system of ectothermic vertebrates // Veterinary Immunology and immunopathology. 1996. V. 54. P. 145-150.

Ghaffari S. H. and Lobb C. J. Structure and genomic organization of immunoglobulin light chain in the channel catfish // The Journal of Immunology. 1993. V. 151. P. 6900-6912.

Gilbert W. Evolution of antibodies: the road not taken // Nature. 1990. V. 320. P. 485.

Greenberg A. S., Steiner L.,Kasahara M., Flajnik M. F. Isolation of a immunoglobulin light chain cDNA clone encoding a protein resembling mammalian k light chains: Implications for the evolution of light chains // Proc. Natl. Acad. Sci. USA. 1993. V. 90. P. 10603-10607.

Haire R. N., Ota T., Rast J. P., Litman R. T., Chan F. Y., Zon L. I., Litman G. W. A third Ig light chain gene isotype in Xenopus laevis consists of six distinct VL families and is related to mammalian l genes // The Journal of Immunology. 1996. V. 157. P. 1544-1550.

Hesse J. E., Lieber M. R., Mizuuchi K., Gellert M. V(D)J recombination: the functional difinition of the joining signals // Genes Dev. 1989. V. 3. P. 1053-1061.

Hieter P. A., Hollis G. F., Korsmeyer S. J., Waldmann T. A., Leder P. Clastered arrangement of immunoglobulin l constant region genes in man // Nature. 1981. V. 294. P. 536.

Hieter P. A., Maizel J. V., Leder J., Leder P. Evolution of human immunoglobulin k J region genes // J. Biol. Chem. 1982. V. 257. P. 1516.

Hohman V. S., Schluter S.F., Marchalonis J. J. Complete sequence of a cDNA clone specifying sandbar shark immunoglobulin light chain: Gene organization and implications for the evolution of light chains // Proc. Natl. Acad. Sci. USA. 1992. V. 89. P. 276-280.

Hohman V. S., Schuchman D. B., Schluter S.F., Marchalonis J. J. Genomic clone for sandbar shark l light chain: Generation diversity in the absence of rearrangement // Proc. Natl. Acad. Sci. USA. 1993. V. 90. P. 9882-9886.

Hsu E., Lefkovits I., Flajnik M., Pasquier L. D. Light chain heterogeneity in the amphibian Xenopus // Molecular Immunology. 1991. V. 28. P. 985-994.

immunoglobulin genes and the antibody repertoire // Molecular Biology Evolution. 1993. V. 10(1). P. 60-72.

Litman G. W., Rast J. p., Shamblott M. J., Haire R. N., Michele H., Roess W., Litman R. T, Hinds-Frey K. R., Zilch A., Amemiya C. T. Phylogenetic diversification of Lobb C. J., Olson M. O. J., Clem W. L. Immunoglobulin light chain classes in a teleost fish // The Journal of Immunology. 1984. V. 132. P. 1917-1923.

Lundqvist M., Bengten E., Stromberg S., Pilstrom L. Ig light chain gene in the siberiah sturgeon (Acipenser baeri) // The Journal of Immunology. 1996. V. 157. P. 2031-2038.

Maisey J. G. Chondrichthyan phylogeny: a look at the evidence // J. Ven. Paleont. 1984. V. 4. P. 359-371.

Rast J. P., Anderson M. k., Ota T. Litman R. T., Margittai M., Shamblott M. J., Litman G. W. Immunoglobulin light chain class multiplisity and alternative organizational form in early vertebrate philogeny // Immunogenetics. 1994. V. 40. P. 83-89.

Reynaund C. A., Anquenz V., Grimal H., Weill J. C. A hyperconversion mechanism generates the chicken light chain preimmune repertoire // Cell. 1987. V. 48. P. 379-388.

Roitt I., Brodstoff J., Male D. Immunology. London: Mosby-Year Book Europe, 1993.

Romer A. S. Vertebrate Paleontology. Chicago: University Chicago Press, 1966.

Sakano H., Huppi K., Heinrich G., Tonegawa S. Sequences at the somatic recombination sites of immunoglobulin light-chain genes // Nature. 1979. V. 280. P. 288.

Sakano H., Maki R., Kurosawa Y., Roeder W., Tonegawa S. Two types of somatic recombination are necessary for the generation of complete immunoglobulin heavy-chain genes // Nature. 1980. V. 286. P. 676.

Sanger F., Niklen, S., Coulson A.R. DNA sequencing with chain-terminating inhibitors // Proc. Natl. Acad. Sci. U S A. 1977. V. 74. P. 5463-5467

Schatz G. D., Oettinger A. M., Schlissel M. S. V(D)J recombination: molecular biology and regulation // Annual Review of Immunology. 1992. V. 10. P. 359-383.

Schwager J., Burckert N., Schwager M., Wilson M. Evolution of immunoglobulin light chain genes: analysis of Xenopus IgL isotypes and their contribution to antibody diversity // The EMBO Journal. 1991. V. 10. P. 505-511.

Seidman J. G., Max E. E., Leder P. A. A k immunoglobulin gene is formed by site - specific recombination without further somatic mutation // Nature. 1979. V. 280. P. 370.

Shamblott M. J. and Litman G. W. Genomic organization and sequences of immunoglobulin light chain genes in a primitive vertebrate suggest coevolution of immunoglobulin gene organization // The EMBO Journal. 1989. V. 8. P. 3733-3739.

Shankey T.V. and Clem L.W. Phylogeny of immunoglobulin structure and function. IX. Intramolecular heterogeneity

of shark 19S IgM antibodies to the dinitrophenyl hapten //

J. Immunol. 1980. V. 125. P. 2690-2698.

Stavnezer J., Kekish O., Batter D., Grenier J., Balazs I., Henderson E., Zegers B. J. Aberrant recombination events in B cell lines derived from k-deficient human // Nucl. Acids Res. 1985. V. 13. P. 3495-3514.

Stewart S. E., Pasquier L. D., Steiner L. A. Diversity of expressed V and J regions of immunoglobulin light chains in Xenopus laevis // European Journal of Immunology. 1993. V. 23. P. 1980-1986.

Strob U. Transgenic mise with immunoglobulin genes // Annual Review of Immunology. 1987. V. 5. P. 151-174.

Thompson G. B. and Neiman P. E. Somatic diversification of the chicken immunoglobulin light chain gene is limited to the rearranged variable gene segment //Cell. 1987. V. 48. P. 369-378.

Tonegawa S. Somatic generation of antibody diversity // Nature. 1983. V. 302. P. 575-581.

Udey J. A., Blomberg B. Human l light chain locus: organization and DNA sequences of three genomic J regions // Immunogenetics. 1987. V. 25. P. 63.

Wai Lin Tung, King-C. Chow. A modified medium for efficient electrotransformation of E.coli // Trends in Genetics. 1995. V. 11. No. 4. Ð. 128-129.

Wilson M., Hsu E., Marcuz A., Courent M., Pasquier L. D., Steinberg C. What limits affinity maturation of antibodies in Xenopus: the rate of somatic mutation or the abilityto select mutants? // The EMBO Journal. 1992. V. 11. P. 4337.

Zezza D. J., Mikoryak C. A., Schwager J., Steiner L. A. Sequence of C region of L chains from Xenopus laevis Ig // The Journal of Immunology. 1991. V. 146. P. 4041-4047.

Zezza D. J., Stewart S. E., Steiner L. A. Genes encoding Xenopus laevis Ig L chains. Implications for the evolution of k and l chains // The Journal of Immunology. 1992. V. 149. P. 3968-3977.

МИНИСТЕРСТВО ОБЩЕГО И ПРОФЕССИОНАЛЬНОГО

ÎÁÐÀÇÎÂÀÍÈЯ РФ

ÍÎÂÎÑÈÁÈÐÑÊÈÉ ÃÎÑÓÄÀÐÑÒÂÅÍÍÛÉ ÓÍÈÂÅÐÑÈÒÅÒ

ÔÀÊÓËÜÒÅÒ ÅÑÒÅÑÒÂÅÍÍÛÕ ÍÀÓÊ

Êàôåäðà öèòîëîãèè è ãåíåòèêè

ÊËÎÍÈÐÎÂÀÍÈÅ È ÀÍÀËÈÇ ÃÅÍΠËÅÃÊÈÕ ÖÅÏÅÉ ÈÌÌÓÍÎÃËÎÁÓËÈÍΠÑÒÅÐËßÄÈ

Äèïëîìíàÿ ðàáîòà

Äåíèñîâà Ñ. Ã.

_____________

Íàó÷íûé ðóêîâîäèòåëü

ê.á.í. Òàðàíèí À. Â.

_____________

Ðàáîòà âûïîëíåíà â

ëàáîðàòîðèè èììóíîãåíåòèêè

Èíñòèòóòà öèòîëîãèè è

ãåíåòèêè ÑÎ ÐÀÍ.

Íîâîñèáèðñê 1997

Похожие работы: